(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE212

PENCW_16.PE212       Location/Qualifiers
FT   CDS             join(482296..482526,482590..482667)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128703"
FT                   /orf_name="Pc20g02120"
FT                   /product="Putative uncharacterized protein Pc20g02120 "
FT                   /protein_id="CAP85541.1"
FT                   /db_xref="UniParc:UPI0001831674"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA1"
FT                   /transl_table=1
FT                   /translation="MAPHGVEGSRIRFSWHRGESEVIWLPLDATSSTPLFVKVLVGYAA
FT                   VRLVRAWSRGKKRRAIPMVVVSSTQHLRNTAQGLVEDERQISRRLGVESDVAVSLGE"
     MAPHGVEGSR IRFSWHRGES EVIWLPLDAT SSTPLFVKVL VGYAAVRLVR AWSRGKKRRA        60
     IPMVVVSSTQ HLRNTAQGLV EDERQISRRL GVESDVAVSL GE                          102
//

If you have problems or comments...

PBIL Back to PBIL home page