(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE215

PENCW_16.PE215       Location/Qualifiers
FT   CDS             join(complement(487938..488898),complement(487218..487912))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194738" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824370"
FT                   /orf_name="Pc20g02150"
FT                   /product="Pc20g02150 protein"
FT                   /protein_id="CAP85544.1"
FT                   /db_xref="UniParc:UPI0001831677"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA4"
FT                   /transl_table=1
FT                   /translation="MESSAGPIFDEAQYRTDVLHLPSPESEAAQAQQLAEEAEQLGLKV
FT                   PEIEVSAPLAASIASGMVDLSSPVLSSGSSTDRNSMCGSLTPSHEPSSPVPSVLDQIVS
FT                   SLSDVTLSSDHIKAGSTRSLASLSTRPTSFCSSEGKPGLIGHGYNDAFEARSHRHSILS
FT                   IASADKKEKRRSSLKSAIGRIHFRKKRTSSAIVLPSDGRIAVSTSDKGVEHVFFEPTQG
FT                   PDNAAHEDVPLHASDEVSLPRLEIPRFSKEELQRSLDDPELSELHERHQMERNRHLAFH
FT                   DAALSTLRRRHQTAVSEHQSDNQRQEDERREKVRVTRFYSLVQNIQAIVQIEERQLAVE
FT                   IEQQREFDRAKMNSRTRIKHMEGYLRNASPPPSPAGTPTKAERSGRSSESFSESGSTPP
FT                   ARVLTRQHMEQLEQQYHSHKSMDQLHDARIKVLRDRQELKLQEATARMEKELDEMRNRH
FT                   IQDVAALKAEHQREESSLVQALETKKTTLQRRWYLEEAILRRHLEVRHGQSYGPLPLVT
FT                   FNTSTTPVGMAEHSPLETSSTPDTIHPSQDCVPL"
     MESSAGPIFD EAQYRTDVLH LPSPESEAAQ AQQLAEEAEQ LGLKVPEIEV SAPLAASIAS        60
     GMVDLSSPVL SSGSSTDRNS MCGSLTPSHE PSSPVPSVLD QIVSSLSDVT LSSDHIKAGS       120
     TRSLASLSTR PTSFCSSEGK PGLIGHGYND AFEARSHRHS ILSIASADKK EKRRSSLKSA       180
     IGRIHFRKKR TSSAIVLPSD GRIAVSTSDK GVEHVFFEPT QGPDNAAHED VPLHASDEVS       240
     LPRLEIPRFS KEELQRSLDD PELSELHERH QMERNRHLAF HDAALSTLRR RHQTAVSEHQ       300
     SDNQRQEDER REKVRVTRFY SLVQNIQAIV QIEERQLAVE IEQQREFDRA KMNSRTRIKH       360
     MEGYLRNASP PPSPAGTPTK AERSGRSSES FSESGSTPPA RVLTRQHMEQ LEQQYHSHKS       420
     MDQLHDARIK VLRDRQELKL QEATARMEKE LDEMRNRHIQ DVAALKAEHQ REESSLVQAL       480
     ETKKTTLQRR WYLEEAILRR HLEVRHGQSY GPLPLVTFNT STTPVGMAEH SPLETSSTPD       540
     TIHPSQDCVP L                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page