(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE216

PENCW_16.PE216       Location/Qualifiers
FT   CDS             complement(489640..490515)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947790"
FT                   /orf_name="Pc20g02160"
FT                   /product="Pc20g02160 protein"
FT                   /protein_id="CAP85545.1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI0001831678"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA5"
FT                   /transl_table=1
FT                   /translation="MDILTYYYNRCFAFIIRTFVYFASNVTASPDEIRHIKSRDAGRTI
FT                   KVHLYQPSGSGPSPVLLNFHGSGFVLPLHGSDDEFCRRVSHETKHTVLDIPYRLAPEHP
FT                   FPAALNDVEDAVRYVLTRPDEFDLTRISISGFSAGGNLALAAASTLFPRDTFRSLLAIY
FT                   PVTNLSPDPASKIAPARGESVIPLPVMRLFDRCYIPSSFDKRDPRISPHYAQADRFPQR
FT                   VLMITADGDTLALEGEELAQKIKKLQGWHVVSERMQGCSHGWDKNARAGTPQYQAKERA
FT                   YQLAFDMLND"
     MDILTYYYNR CFAFIIRTFV YFASNVTASP DEIRHIKSRD AGRTIKVHLY QPSGSGPSPV        60
     LLNFHGSGFV LPLHGSDDEF CRRVSHETKH TVLDIPYRLA PEHPFPAALN DVEDAVRYVL       120
     TRPDEFDLTR ISISGFSAGG NLALAAASTL FPRDTFRSLL AIYPVTNLSP DPASKIAPAR       180
     GESVIPLPVM RLFDRCYIPS SFDKRDPRIS PHYAQADRFP QRVLMITADG DTLALEGEEL       240
     AQKIKKLQGW HVVSERMQGC SHGWDKNARA GTPQYQAKER AYQLAFDMLN D                291
//

If you have problems or comments...

PBIL Back to PBIL home page