(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE218

PENCW_16.PE218       Location/Qualifiers
FT   CDS             493817..495016
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947791"
FT                   /orf_name="Pc20g02180"
FT                   /product="Pc20g02180 protein"
FT                   /protein_id="CAP85547.1"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniParc:UPI0001831679"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA6"
FT                   /transl_table=1
FT                   /translation="MSTPLLGEMSPAEAESVYFNEYPPPKALPRHEALARAFIDLHVEA
FT                   HRRVVLVTSGGTTVPLEAQTVRFIDNFSAGTRGATSAEYFLEQGYAVIFLHRQYSLLPY
FT                   SRHYSHSTNCFLDFMDEAPASADSSNPGHGPIMVRDEYQDQMRSVLRKYRYAKQNNRLL
FT                   LLPFTTVSEYMFELRSIAKLMRPLGPDALFYLAAAVSDFFIPRSRMAEHKIQSSELPPH
FT                   MRGSAISSDEIYTGENEEKASSNSRKLVINLDPVPKFLHQLVDGWAPEGSMVVSFKLET
FT                   DPSLLVYKARTALQRYSHHLVIGNLLSTRKWEVVFITPDEPHERWLRVPKSRRSKSISG
FT                   VEDQVGLAEAKKGNPSTSEEAKAEQVNETSRDGIEIESLIIPELVKLHTKMIEKTQAAQ
FT                   "
     MSTPLLGEMS PAEAESVYFN EYPPPKALPR HEALARAFID LHVEAHRRVV LVTSGGTTVP        60
     LEAQTVRFID NFSAGTRGAT SAEYFLEQGY AVIFLHRQYS LLPYSRHYSH STNCFLDFMD       120
     EAPASADSSN PGHGPIMVRD EYQDQMRSVL RKYRYAKQNN RLLLLPFTTV SEYMFELRSI       180
     AKLMRPLGPD ALFYLAAAVS DFFIPRSRMA EHKIQSSELP PHMRGSAISS DEIYTGENEE       240
     KASSNSRKLV INLDPVPKFL HQLVDGWAPE GSMVVSFKLE TDPSLLVYKA RTALQRYSHH       300
     LVIGNLLSTR KWEVVFITPD EPHERWLRVP KSRRSKSISG VEDQVGLAEA KKGNPSTSEE       360
     AKAEQVNETS RDGIEIESLI IPELVKLHTK MIEKTQAAQ                              399
//

If you have problems or comments...

PBIL Back to PBIL home page