(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE219

PENCW_16.PE219       Location/Qualifiers
FT   CDS             join(495698..496702,496778..497107)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977592"
FT                   /orf_name="Pc20g02190"
FT                   /product="Pc20g02190 protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85548.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR003378"
FT                   /db_xref="UniParc:UPI000183167A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA7"
FT                   /transl_table=1
FT                   /translation="MVPRRLSRRLIAVAAAIALFFLYHVSSLSSHNRQWRPHFTTTEVT
FT                   PAVGDNGEPAPFCPPLPGIEDVLVVMKTGVTESRDKVPIHFQTTLRCIPHFVIYSDFAE
FT                   EIEGVKIHDVLRNMDSAAKKNPDFDFYHRIVKYGRKGLEQQDFSDEANSAIGKPNNPGW
FT                   KLDKWKFLPMAQEALRHKPDAKWFIFVEADTYVSWPTVLTWLARFDHTKPHYLGTETQI
FT                   ADVIFAHGGSGFMLSNPALQRASDEYAAREVELNAFTDQHWAGDCVLGKVLSDAGVNLH
FT                   FTWPILQNSNLGELDEFTTDFYRKPWCFIAVALHHLSPIDIENLWKFEQKRWRDKNKRI
FT                   LLHGDLFREYISPEINSQPTRPNWNNMANEDQPFAHTFEDCRLICQTQNACVQFAFREG
FT                   KCFTSANPRLGHAVPSGDATSGWITSRIRDMTGKKGLCRKPDFGD"
     MVPRRLSRRL IAVAAAIALF FLYHVSSLSS HNRQWRPHFT TTEVTPAVGD NGEPAPFCPP        60
     LPGIEDVLVV MKTGVTESRD KVPIHFQTTL RCIPHFVIYS DFAEEIEGVK IHDVLRNMDS       120
     AAKKNPDFDF YHRIVKYGRK GLEQQDFSDE ANSAIGKPNN PGWKLDKWKF LPMAQEALRH       180
     KPDAKWFIFV EADTYVSWPT VLTWLARFDH TKPHYLGTET QIADVIFAHG GSGFMLSNPA       240
     LQRASDEYAA REVELNAFTD QHWAGDCVLG KVLSDAGVNL HFTWPILQNS NLGELDEFTT       300
     DFYRKPWCFI AVALHHLSPI DIENLWKFEQ KRWRDKNKRI LLHGDLFREY ISPEINSQPT       360
     RPNWNNMANE DQPFAHTFED CRLICQTQNA CVQFAFREGK CFTSANPRLG HAVPSGDATS       420
     GWITSRIRDM TGKKGLCRKP DFGD                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page