(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE22

PENCW_16.PE22        Location/Qualifiers
FT   CDS             join(61865..62005,62062..62380,62432..62526)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946679"
FT                   /orf_name="Pc20g00220"
FT                   /product="Pc20g00220 protein"
FT                   /protein_id="CAP85351.1"
FT                   /db_xref="UniParc:UPI000183190E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF33"
FT                   /transl_table=1
FT                   /translation="MAAVRLRKAFRYPEESEGEREELDEEQQERVIEQLQSQNDARNAQ
FT                   YSMIFTALPVLAATVFVPSVLSASSQAERLFSLLGLASLLTTAYIMKCFPLHPDRKGKK
FT                   PMTFHTERIARLHAALVPGTSAVCLLLAVVYLSTEPSYAVHPVLYLIPGAMLAVILLAQ
FT                   KVMLSVDLASLKDLQYEYKGA"
     MAAVRLRKAF RYPEESEGER EELDEEQQER VIEQLQSQND ARNAQYSMIF TALPVLAATV        60
     FVPSVLSASS QAERLFSLLG LASLLTTAYI MKCFPLHPDR KGKKPMTFHT ERIARLHAAL       120
     VPGTSAVCLL LAVVYLSTEP SYAVHPVLYL IPGAMLAVIL LAQKVMLSVD LASLKDLQYE       180
     YKGA                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page