(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE220

PENCW_16.PE220       Location/Qualifiers
FT   CDS             join(complement(498803..499273),complement(498234..498640),
FT                   complement(498096..498181),complement(497721..498040))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947792"
FT                   /orf_name="Pc20g02200"
FT                   /product="Pc20g02200 protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85549.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniParc:UPI000183167B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA8"
FT                   /transl_table=1
FT                   /translation="MHWLFIGSAALFLFLPASALSRGIVDHGHWNELRDLTHNASHNGS
FT                   QAKSSPPLVIDTFKNPTRNDLGFWHGSGENLTVQHGPGFVRLFPTDPDQNFHTQFDSNA
FT                   CYGLIPWYNEYLHVIFEGTDQYSVSFNQHNDECNPQRRPFPGIADSVQAERYVLYIPLA
FT                   HFDIDFNRVVSVSFHGFYTNESITLHRVEIVPDVPLPSPENGHYLVPGKMPNGKLVLRC
FT                   SRPNSFAFGIDDGQPQYSQQVMRILDEEGVRVTFFVVGAGLRDPTSNFTEFYKEMLRKG
FT                   HQVAFHSNTHPKMESLPTLAEIDDEIMQSMRIFREQLGIESSYFRPPFGTVASRLRQEL
FT                   ARHIPNPSIVNWSVDVEDWLWADTSTPEKQLEAFFRSVEKGGNLAVMHYLHPTTIGYLP
FT                   EFIRHVKRAGYQIMRIDQCLGDASAPPL"
     MHWLFIGSAA LFLFLPASAL SRGIVDHGHW NELRDLTHNA SHNGSQAKSS PPLVIDTFKN        60
     PTRNDLGFWH GSGENLTVQH GPGFVRLFPT DPDQNFHTQF DSNACYGLIP WYNEYLHVIF       120
     EGTDQYSVSF NQHNDECNPQ RRPFPGIADS VQAERYVLYI PLAHFDIDFN RVVSVSFHGF       180
     YTNESITLHR VEIVPDVPLP SPENGHYLVP GKMPNGKLVL RCSRPNSFAF GIDDGQPQYS       240
     QQVMRILDEE GVRVTFFVVG AGLRDPTSNF TEFYKEMLRK GHQVAFHSNT HPKMESLPTL       300
     AEIDDEIMQS MRIFREQLGI ESSYFRPPFG TVASRLRQEL ARHIPNPSIV NWSVDVEDWL       360
     WADTSTPEKQ LEAFFRSVEK GGNLAVMHYL HPTTIGYLPE FIRHVKRAGY QIMRIDQCLG       420
     DASAPPL                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page