(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE221

PENCW_16.PE221       Location/Qualifiers
FT   CDS             join(complement(502189..502559),complement(502069..502126),
FT                   complement(501882..502017),complement(501468..501828),
FT                   complement(501326..501405),complement(501078..501229),
FT                   complement(500812..501005),complement(500612..500760),
FT                   complement(499950..500527))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947793"
FT                   /orf_name="Pc20g02210"
FT                   /product="Pc20g02210 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP85550.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001831751"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA9"
FT                   /transl_table=1
FT                   /translation="MESYDDPEVASAADAPEVGDSAAAEAASAVGSDVGEPPVAGVLSG
FT                   VGPNAEAAHQIARDKGWTDPVPFEYAELANSKDHLEWAGVAARYEWKGEYGDIGPRVPE
FT                   LEEQLFSGDLIARAGAKLDALNGYKVKVESASEIESVTEWVNLGLHPVMLENVRLCGYE
FT                   HPTAVQSYAIPAVLANLDVIAVAQTGSGKTGAFLIPILSKLMGKARKLAAPRPNTAERF
FT                   NPREDAVRAEPLVLIVCPTRELATQIFDEARRLCYRSMLRPCVAYGGAPSRQQREELQK
FT                   GCDILIATPGRLLDFMAQTHVLSLRRVRYTVIDEADEMLESDWEEEFKKIMSGGDVNED
FT                   ADHRYMMFSATFNKEFRKLAKQYLNENHVRLRVGRAGSSHHNVVQDIIWADQPKKMRAL
FT                   YDLLISMPPVRTLIFVNSKEQVDFVDDYLFNSGMPTTSIHGGRTQREREDAMRAFRTAK
FT                   CPIMVATGVSARGLDVVNVLHVINYDLPSAIHGGITEYVHRIGRTARIGNEGIATSFYN
FT                   DRDEGIAEDLVKILIECDQAIPEFLQQYRPEGDVLEFDDDSDKEFFDNQSNAGAEAEAD
FT                   HESSNADAESAAAEAEADHESSNADAESAAAQAEAEESDKVVADDAEDDKPAVPRPTIT
FT                   SEEEEEASTWWGPTTIVTERKKPREEAKPKDTKAGLAGSHWAPKPKPAPKDDDAFWQ"
     MESYDDPEVA SAADAPEVGD SAAAEAASAV GSDVGEPPVA GVLSGVGPNA EAAHQIARDK        60
     GWTDPVPFEY AELANSKDHL EWAGVAARYE WKGEYGDIGP RVPELEEQLF SGDLIARAGA       120
     KLDALNGYKV KVESASEIES VTEWVNLGLH PVMLENVRLC GYEHPTAVQS YAIPAVLANL       180
     DVIAVAQTGS GKTGAFLIPI LSKLMGKARK LAAPRPNTAE RFNPREDAVR AEPLVLIVCP       240
     TRELATQIFD EARRLCYRSM LRPCVAYGGA PSRQQREELQ KGCDILIATP GRLLDFMAQT       300
     HVLSLRRVRY TVIDEADEML ESDWEEEFKK IMSGGDVNED ADHRYMMFSA TFNKEFRKLA       360
     KQYLNENHVR LRVGRAGSSH HNVVQDIIWA DQPKKMRALY DLLISMPPVR TLIFVNSKEQ       420
     VDFVDDYLFN SGMPTTSIHG GRTQREREDA MRAFRTAKCP IMVATGVSAR GLDVVNVLHV       480
     INYDLPSAIH GGITEYVHRI GRTARIGNEG IATSFYNDRD EGIAEDLVKI LIECDQAIPE       540
     FLQQYRPEGD VLEFDDDSDK EFFDNQSNAG AEAEADHESS NADAESAAAE AEADHESSNA       600
     DAESAAAQAE AEESDKVVAD DAEDDKPAVP RPTITSEEEE EASTWWGPTT IVTERKKPRE       660
     EAKPKDTKAG LAGSHWAPKP KPAPKDDDAF WQ                                     692
//

If you have problems or comments...

PBIL Back to PBIL home page