(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE222

PENCW_16.PE222       Location/Qualifiers
FT   CDS             join(503454..503672,503810..504092,504148..504676,
FT                   504726..505053)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947794"
FT                   /orf_name="Pc20g02220"
FT                   /product="Pc20g02220 protein"
FT                   /function="ATP binding"
FT                   /function="pantothenate kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /protein_id="CAP85551.1"
FT                   /db_xref="GO:0004594"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="InterPro:IPR011602"
FT                   /db_xref="UniParc:UPI0001831752"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB0"
FT                   /transl_table=1
FT                   /translation="MAERVEVDTRKRPNRLEAAITNPGAVKINVTGAFIVDDEPRSKSP
FT                   VDAEGVHYENKDIRLPHHTGVVSHVAVDIGGTLAKLVYFTRELDTADNGGRLNFLNFET
FT                   HRIDLCINFIRQLKEEHEKRNGSTREGLCVVATGGGAYKYYDRLKEELNVNILREEEME
FT                   CLIIGLDFFITEIPNEVFTYSDADPEPMQYAEARADVYPYLLVNIGSGVSMIKVSGPRQ
FT                   FERVGGTHLGGGTFWGIMSLLTGSRTFDDMLAMADRGDNSAVDMLVGDIYGMDYTKIGL
FT                   KSTAIASTFGKVLRLKNDAEQGAEDGEGLIRDDPSEASESSKSSHGAKPNPEDMSRSLL
FT                   YAISNNIGQIAYLQSEKHSVKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRH
FT                   EGYLGAVGAFIRRQPQNWGRRNSVDDVVAPQAVRNLVQNNSVLQQHGRSSSDL"
     MAERVEVDTR KRPNRLEAAI TNPGAVKINV TGAFIVDDEP RSKSPVDAEG VHYENKDIRL        60
     PHHTGVVSHV AVDIGGTLAK LVYFTRELDT ADNGGRLNFL NFETHRIDLC INFIRQLKEE       120
     HEKRNGSTRE GLCVVATGGG AYKYYDRLKE ELNVNILREE EMECLIIGLD FFITEIPNEV       180
     FTYSDADPEP MQYAEARADV YPYLLVNIGS GVSMIKVSGP RQFERVGGTH LGGGTFWGIM       240
     SLLTGSRTFD DMLAMADRGD NSAVDMLVGD IYGMDYTKIG LKSTAIASTF GKVLRLKNDA       300
     EQGAEDGEGL IRDDPSEASE SSKSSHGAKP NPEDMSRSLL YAISNNIGQI AYLQSEKHSV       360
     KHIYFGGSFI RGHRQTMNTL SYAIRFWSKG EKQAYFLRHE GYLGAVGAFI RRQPQNWGRR       420
     NSVDDVVAPQ AVRNLVQNNS VLQQHGRSSS DL                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page