(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE223

PENCW_16.PE223       Location/Qualifiers
FT   CDS             505713..507248
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671679"
FT                   /orf_name="Pc20g02230"
FT                   /product="Pc20g02230 protein"
FT                   /protein_id="CAP85552.1"
FT                   /db_xref="UniParc:UPI0001831753"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB1"
FT                   /transl_table=1
FT                   /translation="MAESPLHVISDQLKRLAAQSPAARNASPVSAARVDATEPIIQGSV
FT                   LNAPEGTDSQVPTSTESDLTDIDESLLQDPSDPAPRPQSTPSETHFINPTAPRVSYQVS
FT                   ASGEVMIIEETQTPRPIARAPAPRPSPPAYLSFDRLAQGLSPKLASSPTTSTIQPPSLA
FT                   VERIIGPKQPIPARILELLEEWHEDSPYTEHPSALSGRAPTTWKHFKAFSDDGDECELS
FT                   IFQISLKGQTRRSVTYRIMILHSQNGPEELVVYGQPRPKFRGPLTKGTRGLYLLDWLEI
FT                   EQKGEVQACGLKLWRTDEQNITFSAHMFDYGRKCTRLSGPNDIFNMRASSSTPKKQSGA
FT                   NENIEDAGSNSSEPPYSPSRSSRQASTSNHPKPENEEDKTSVTPRPSPAKTGSPEFRPL
FT                   ASPWKPQKRRRGTWSSNDETSVLRYKLMSDESDQVRVFKTNDAKVLFEKAQQFYKGMEK
FT                   RTGLLCTVYGVEGVRYVGEGCVDEFDILQEDIRKTSGPGDEDRVVVVKPAMGF"
     MAESPLHVIS DQLKRLAAQS PAARNASPVS AARVDATEPI IQGSVLNAPE GTDSQVPTST        60
     ESDLTDIDES LLQDPSDPAP RPQSTPSETH FINPTAPRVS YQVSASGEVM IIEETQTPRP       120
     IARAPAPRPS PPAYLSFDRL AQGLSPKLAS SPTTSTIQPP SLAVERIIGP KQPIPARILE       180
     LLEEWHEDSP YTEHPSALSG RAPTTWKHFK AFSDDGDECE LSIFQISLKG QTRRSVTYRI       240
     MILHSQNGPE ELVVYGQPRP KFRGPLTKGT RGLYLLDWLE IEQKGEVQAC GLKLWRTDEQ       300
     NITFSAHMFD YGRKCTRLSG PNDIFNMRAS SSTPKKQSGA NENIEDAGSN SSEPPYSPSR       360
     SSRQASTSNH PKPENEEDKT SVTPRPSPAK TGSPEFRPLA SPWKPQKRRR GTWSSNDETS       420
     VLRYKLMSDE SDQVRVFKTN DAKVLFEKAQ QFYKGMEKRT GLLCTVYGVE GVRYVGEGCV       480
     DEFDILQEDI RKTSGPGDED RVVVVKPAMG F                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page