(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE224

PENCW_16.PE224       Location/Qualifiers
FT   CDS             join(507964..508291,508369..508634,508968..509546)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947795"
FT                   /orf_name="Pc20g02240"
FT                   /product="Pc20g02240 protein"
FT                   /function="phosphatidylinositol N-
FT                   acetylglucosaminyltransferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85553.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017176"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniParc:UPI0001831754"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB2"
FT                   /transl_table=1
FT                   /translation="MASPPSLDPFPPPIPVDTHPNRATGSKPPELERSLPDPNRLAPED
FT                   AYFAPSLSRARSAPSNYEENLRSLNGDGSAHIGSTAALRKKLGGPGRRRKRKGAWKKLL
FT                   WVKQSYPDNYTDTETFLDHLQRNPRVRPYDFWPLVADSTVIVQHVCSVVIFVCCFVGIV
FT                   QDRVSPVSIVCWGSVGTAVGWILWDNWIWKEHGESRLTTVKSAFLIYFSLLGLSPILKS
FT                   LTKSTASDSIWAMSCWLLIMNIFSFDYGSGEGAGATTKFPASLSTNAAVMASTVLASRL
FT                   PSTTHVFSLMLFSMEVFGLFPIFRRQLRQKSWTGHVLLTLALVIVAGGAVGVTLSGGWA
FT                   AAIIGSVLGSILTAFVMGGCSWWLISLQKYKNVVIGPWDPARPIIRRHWN"
     MASPPSLDPF PPPIPVDTHP NRATGSKPPE LERSLPDPNR LAPEDAYFAP SLSRARSAPS        60
     NYEENLRSLN GDGSAHIGST AALRKKLGGP GRRRKRKGAW KKLLWVKQSY PDNYTDTETF       120
     LDHLQRNPRV RPYDFWPLVA DSTVIVQHVC SVVIFVCCFV GIVQDRVSPV SIVCWGSVGT       180
     AVGWILWDNW IWKEHGESRL TTVKSAFLIY FSLLGLSPIL KSLTKSTASD SIWAMSCWLL       240
     IMNIFSFDYG SGEGAGATTK FPASLSTNAA VMASTVLASR LPSTTHVFSL MLFSMEVFGL       300
     FPIFRRQLRQ KSWTGHVLLT LALVIVAGGA VGVTLSGGWA AAIIGSVLGS ILTAFVMGGC       360
     SWWLISLQKY KNVVIGPWDP ARPIIRRHWN                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page