(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE226

PENCW_16.PE226       Location/Qualifiers
FT   CDS             join(complement(515148..515444),complement(512152..515097))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977593"
FT                   /orf_name="Pc20g02260"
FT                   /product="Pc20g02260 protein"
FT                   /function="acyl carrier activity"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85555.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0001831756"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB4"
FT                   /transl_table=1
FT                   /translation="MATVTITTTEGGVKPLQTQDIATRLLNGTLHSQWPPFEQFATIDG
FT                   LLKSHAAQPDEAKRPLICYPIRGAADFEEHTAGAIDRYTDLAVRFYMQQGLVPADPNLE
FT                   QAPVVAMLAGSSFEVVVTFFALNRLGYAVLFLSTRLTAPAYIRLMEMANCSQLIKANQF
FT                   QQVVTEICAERPGCSTFSLLQREDWFNRPVSTPLFERPGADPSGEGKKIAWILHSSGST
FT                   GFPKPIFLTNLQTLANFCKSFGLRLFTISPLFHSHALMEFGRAFYTRAPAYLGNHSLPV
FT                   TYQNLFDALQVAKPQQISAVPYVIKLLAEKQEGIQALARPQLVLYGGSSCPDDLGDRLV
FT                   AQGVNLVGNYGATETGQIMTSFRAPEDKEWQYMRLHRPVADLTLMDEISPGVFECVALD
FT                   GLPSKGPSNSKPPYSAKNPENSFRTADLFTRHPDPEKDNYYKYLSRLDDRITLVNGEKV
FT                   LPIPIEGRVREEPIVSDCVVFGFQRTVPGALIFRAPGKVPHLSDAEFLEAIWPAVEAAN
FT                   SRAETFSRIPKELVVIEGSDVVYARTDKGTCIRAQVYQQFEEDIKQAYAKFEGSGQKRG
FT                   SLALSIPQLEDWLLSRFSEDLGVLIPGAEADIFSAGVDSLQTTQIWRCIMRDIDIGEGG
FT                   DQLSQNIVFEKGTVSALARHLYQLRTGQEFEREDELHSMREMIEKYSHFTHHFPTIARS
FT                   PETEVVMVTGATGNLGAFIVSELLKRPTVSEVWAIVRAPGQAAAGARLYKALADRSIVL
FT                   TEPEAAKLHAVPGDMSQPNLGLKDHDLQHLVSCLTCIIHSAWAVNFNLGVRSFEQQHIR
FT                   GTYNLINLCLRSHLPSPARFFFCSSVSAAGNTPKPASIPETIIEDLEHAQRTGYGRSKL
FT                   VTEHITRNAMRQTGMQARVLRIGQLGGDTVGAQWNDTEAVALMFRSALTTGALPELNER
FT                   PSWLPVDQCGRAISDIAMNVSGSADLNMVYHLVNPRTFSWKDDLLPALRQGSALAEFEV
FT                   VPPQEWLSRLATSEQDPEKNPSVKLIDFWRSKYASHGLSETGPGRNEEAGLTFETERTV
FT                   QDCPSLGLVEDPVASGLIQRYIESWMSRWAGE"
     MATVTITTTE GGVKPLQTQD IATRLLNGTL HSQWPPFEQF ATIDGLLKSH AAQPDEAKRP        60
     LICYPIRGAA DFEEHTAGAI DRYTDLAVRF YMQQGLVPAD PNLEQAPVVA MLAGSSFEVV       120
     VTFFALNRLG YAVLFLSTRL TAPAYIRLME MANCSQLIKA NQFQQVVTEI CAERPGCSTF       180
     SLLQREDWFN RPVSTPLFER PGADPSGEGK KIAWILHSSG STGFPKPIFL TNLQTLANFC       240
     KSFGLRLFTI SPLFHSHALM EFGRAFYTRA PAYLGNHSLP VTYQNLFDAL QVAKPQQISA       300
     VPYVIKLLAE KQEGIQALAR PQLVLYGGSS CPDDLGDRLV AQGVNLVGNY GATETGQIMT       360
     SFRAPEDKEW QYMRLHRPVA DLTLMDEISP GVFECVALDG LPSKGPSNSK PPYSAKNPEN       420
     SFRTADLFTR HPDPEKDNYY KYLSRLDDRI TLVNGEKVLP IPIEGRVREE PIVSDCVVFG       480
     FQRTVPGALI FRAPGKVPHL SDAEFLEAIW PAVEAANSRA ETFSRIPKEL VVIEGSDVVY       540
     ARTDKGTCIR AQVYQQFEED IKQAYAKFEG SGQKRGSLAL SIPQLEDWLL SRFSEDLGVL       600
     IPGAEADIFS AGVDSLQTTQ IWRCIMRDID IGEGGDQLSQ NIVFEKGTVS ALARHLYQLR       660
     TGQEFEREDE LHSMREMIEK YSHFTHHFPT IARSPETEVV MVTGATGNLG AFIVSELLKR       720
     PTVSEVWAIV RAPGQAAAGA RLYKALADRS IVLTEPEAAK LHAVPGDMSQ PNLGLKDHDL       780
     QHLVSCLTCI IHSAWAVNFN LGVRSFEQQH IRGTYNLINL CLRSHLPSPA RFFFCSSVSA       840
     AGNTPKPASI PETIIEDLEH AQRTGYGRSK LVTEHITRNA MRQTGMQARV LRIGQLGGDT       900
     VGAQWNDTEA VALMFRSALT TGALPELNER PSWLPVDQCG RAISDIAMNV SGSADLNMVY       960
     HLVNPRTFSW KDDLLPALRQ GSALAEFEVV PPQEWLSRLA TSEQDPEKNP SVKLIDFWRS      1020
     KYASHGLSET GPGRNEEAGL TFETERTVQD CPSLGLVEDP VASGLIQRYI ESWMSRWAGE      1080
//

If you have problems or comments...

PBIL Back to PBIL home page