(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE228

PENCW_16.PE228       Location/Qualifiers
FT   CDS             join(519649..519772,519836..519861,519919..519955,
FT                   520009..520082,520149..520528,520601..521126)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824372"
FT                   /orf_name="Pc20g02280"
FT                   /product="Pc20g02280 protein"
FT                   /protein_id="CAP85557.1"
FT                   /db_xref="UniParc:UPI0001831758"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB6"
FT                   /transl_table=1
FT                   /translation="MIDDHHQKTALGIVVAFTILGGIAVLLRLWSRWLSRSTLTVDDYL
FT                   IVVGYILAISQSVASWYYIKTNYVGIHVWDIPKSYNPRPGLNWNFANQLLYNPALTVVK
FT                   LSILVFLRRLDSRSRVVKYLILSSYVVVISLFIAVLFVDIFQCHPVQYVYDTTIPGGKC
FT                   INQGAFFVSTAALNLFTDIMVLAIPIIITARLQMPLRRKVAVCVILCLGGVATAIGVWR
FT                   VIILAKGFLSHTPNPDATYGIGFCSSAIEVNVAVVTACGPSLKAISSRFLPRLLDSSRG
FT                   KSTYGAGTGSRTLRSNRFKSASHAQPSVHSTRGADYEMADPLGGPRVDIIGDFEMRKYK
FT                   RGESSSLSSGDDKGIMKTTDISVGYSMEPRVGDGRSQEGRPASVDSMI"
     MIDDHHQKTA LGIVVAFTIL GGIAVLLRLW SRWLSRSTLT VDDYLIVVGY ILAISQSVAS        60
     WYYIKTNYVG IHVWDIPKSY NPRPGLNWNF ANQLLYNPAL TVVKLSILVF LRRLDSRSRV       120
     VKYLILSSYV VVISLFIAVL FVDIFQCHPV QYVYDTTIPG GKCINQGAFF VSTAALNLFT       180
     DIMVLAIPII ITARLQMPLR RKVAVCVILC LGGVATAIGV WRVIILAKGF LSHTPNPDAT       240
     YGIGFCSSAI EVNVAVVTAC GPSLKAISSR FLPRLLDSSR GKSTYGAGTG SRTLRSNRFK       300
     SASHAQPSVH STRGADYEMA DPLGGPRVDI IGDFEMRKYK RGESSSLSSG DDKGIMKTTD       360
     ISVGYSMEPR VGDGRSQEGR PASVDSMI                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page