(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE233

PENCW_16.PE233       Location/Qualifiers
FT   CDS             join(529691..529880,529948..530165,530227..531501)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000135353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671680"
FT                   /orf_name="Pc20g02330"
FT                   /product="Pc20g02330 protein"
FT                   /function="sulfuric ester hydrolase activity"
FT                   /protein_id="CAP85562.1"
FT                   /db_xref="GO:0008484"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0001831759"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED5"
FT                   /transl_table=1
FT                   /translation="MTRPNFLVIVADDLGFSDTGAFGGEIKTPNIDNLANGRLRFTDFH
FT                   AASACSPTRAMLLSGTDNHIAGIGTMSETWTGDQKGKPGYEGYLNDRVAPFPELLQAAG
FT                   YHTLMSGKWHLGLTPERWPCRRGFDRSFSLLPGAANHYAWEPQLEESNNAPGLLGETNV
FT                   FYVENDKHIQPQELGDDFYSSDAFATKLIRYLDERDAAEKEKPFFAYLAFSAPHWPLQA
FT                   PDSDIQDYRGVYDEGPEALRQRRLKRLKELGLIPEHTVPHDVVAVGGHDLSRDWGELDA
FT                   EKQAFSARTMECYSGMVQNMDRHIGRVVEYLREQGELENTFILFMSDNGAEGLLLEAIP
FT                   IIKGDVHDHIAQYYDNSLQNMGRKNSYVWYGPHWASAATAPGRLYKSFTTEGGIRVPFI
FT                   LNYPPLTARSYPGGIDHSFATVMDIAPTILELAGVDHPGTTYRGRTVAPIRGKSWVPYL
FT                   TGQTGSIHSDNAVMAWELFGRQAIRKGRYKAVYIPKPYGPERWQLYDLVQDPGERDDLT
FT                   DHLPDTFADLIKEWDRYVYDVGLVQGSAQPSYVVEEKGYCYED"
     MTRPNFLVIV ADDLGFSDTG AFGGEIKTPN IDNLANGRLR FTDFHAASAC SPTRAMLLSG        60
     TDNHIAGIGT MSETWTGDQK GKPGYEGYLN DRVAPFPELL QAAGYHTLMS GKWHLGLTPE       120
     RWPCRRGFDR SFSLLPGAAN HYAWEPQLEE SNNAPGLLGE TNVFYVENDK HIQPQELGDD       180
     FYSSDAFATK LIRYLDERDA AEKEKPFFAY LAFSAPHWPL QAPDSDIQDY RGVYDEGPEA       240
     LRQRRLKRLK ELGLIPEHTV PHDVVAVGGH DLSRDWGELD AEKQAFSART MECYSGMVQN       300
     MDRHIGRVVE YLREQGELEN TFILFMSDNG AEGLLLEAIP IIKGDVHDHI AQYYDNSLQN       360
     MGRKNSYVWY GPHWASAATA PGRLYKSFTT EGGIRVPFIL NYPPLTARSY PGGIDHSFAT       420
     VMDIAPTILE LAGVDHPGTT YRGRTVAPIR GKSWVPYLTG QTGSIHSDNA VMAWELFGRQ       480
     AIRKGRYKAV YIPKPYGPER WQLYDLVQDP GERDDLTDHL PDTFADLIKE WDRYVYDVGL       540
     VQGSAQPSYV VEEKGYCYED                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page