(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE234

PENCW_16.PE234       Location/Qualifiers
FT   CDS             complement(531801..532268)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977594"
FT                   /orf_name="Pc20g02340"
FT                   /product="Pc20g02340 protein"
FT                   /protein_id="CAP85563.1"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI000183175A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED6"
FT                   /transl_table=1
FT                   /translation="MSSTIPYFRPSNHAQGLANYPHARTVPSSNGQGSYIYVSGTSSRR
FT                   GDGTFVGATRTEDSAGKVTLDLDIRQQTASVLSNIHADIQAASKGKAGIHDVVDATVFL
FT                   TSINGDYSGMNEEWNRVWPDRTTAPARTTVEVRALPREEILVEIKCVAYYQ"
     MSSTIPYFRP SNHAQGLANY PHARTVPSSN GQGSYIYVSG TSSRRGDGTF VGATRTEDSA        60
     GKVTLDLDIR QQTASVLSNI HADIQAASKG KAGIHDVVDA TVFLTSINGD YSGMNEEWNR       120
     VWPDRTTAPA RTTVEVRALP REEILVEIKC VAYYQ                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page