(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE236

PENCW_16.PE236       Location/Qualifiers
FT   CDS             join(complement(535674..536296),complement(535150..535612))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000254105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947798"
FT                   /orf_name="Pc20g02360"
FT                   /product="Pc20g02360 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85565.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI000183175C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED8"
FT                   /transl_table=1
FT                   /translation="MPPYLPDFSTSHCMSQSNSQEWITLRPHDTPGGISDGQNSPTASK
FT                   VDMFVGDRFFRTVEPNCFDPYVRIAEMDASGVDVQVISTVPVLFSYDKPVEPAAAMARY
FT                   LNDHIASVCRDHPRRFVGLATVPLQDVAVSIKELRRAKDILGLKGVEIGTEVSGKTLNS
FT                   ADFEPFWTACEELDFPIFVHPLGYELEQENKERWGKYWSAWLIGMPSETALAMHSILSS
FT                   GVLVRHPNLRFCFAHAGGAYLPLLGRIQHGYDCRPDLVAHSSQGVLPQDYIQSQQHNIW
FT                   LDSLVHDPDLLQFICKKIGAERIIMGSDYPFPLGEMPVPGEMLASDAQVGSFLSQEKRA
FT                   QMLSGNAIEFLGLEGMFPGCK"
     MPPYLPDFST SHCMSQSNSQ EWITLRPHDT PGGISDGQNS PTASKVDMFV GDRFFRTVEP        60
     NCFDPYVRIA EMDASGVDVQ VISTVPVLFS YDKPVEPAAA MARYLNDHIA SVCRDHPRRF       120
     VGLATVPLQD VAVSIKELRR AKDILGLKGV EIGTEVSGKT LNSADFEPFW TACEELDFPI       180
     FVHPLGYELE QENKERWGKY WSAWLIGMPS ETALAMHSIL SSGVLVRHPN LRFCFAHAGG       240
     AYLPLLGRIQ HGYDCRPDLV AHSSQGVLPQ DYIQSQQHNI WLDSLVHDPD LLQFICKKIG       300
     AERIIMGSDY PFPLGEMPVP GEMLASDAQV GSFLSQEKRA QMLSGNAIEF LGLEGMFPGC       360
     K                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page