(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE237

PENCW_16.PE237       Location/Qualifiers
FT   CDS             join(536814..536988,537065..537078,537150..537255,
FT                   537305..537567)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000218448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947799"
FT                   /orf_name="Pc20g02370"
FT                   /product="Pc20g02370 protein"
FT                   /function="3-hydroxyanthranilate 3,4-dioxygenase activity "
FT                   /function="iron ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85566.1"
FT                   /db_xref="GO:0000334"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000183175D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED9"
FT                   /transl_table=1
FT                   /translation="MEHASSAQTSIPGPVTLHSWLSANAQKLQPPVNNQCLYSGKDFIL
FT                   MAVGGPNTRNDYHINQTEEWFYQIKGDMLLKIVENGTCFRDIEIREGEMFLLPGDIPHC
FT                   PIRYEETIGLVMERTRPPHVVDRIRWYCPNADAHRTVPSIIREESFHCADIETQLKDLI
FT                   NHWMTDESTRKCGGCGEIAPPH"
     MEHASSAQTS IPGPVTLHSW LSANAQKLQP PVNNQCLYSG KDFILMAVGG PNTRNDYHIN        60
     QTEEWFYQIK GDMLLKIVEN GTCFRDIEIR EGEMFLLPGD IPHCPIRYEE TIGLVMERTR       120
     PPHVVDRIRW YCPNADAHRT VPSIIREESF HCADIETQLK DLINHWMTDE STRKCGGCGE       180
     IAPPH                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page