(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE239

PENCW_16.PE239       Location/Qualifiers
FT   CDS             540948..542402
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947800"
FT                   /orf_name="Pc20g02390"
FT                   /product="Pc20g02390 protein"
FT                   /protein_id="CAP85568.1"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniParc:UPI0001831835"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE1"
FT                   /transl_table=1
FT                   /translation="MKSETTSRHHAAPAKIRDAFSRAMSAMYASEVPLYGRLLSLVSRV
FT                   NKTTLEQDGLLRQRLEATDDLDRIDMERHGAIRVGTPAELHSVRRVLHVMNMLPTGFYD
FT                   LSAAGVPVYATCFRPHSASELSKNPFRLFVSLLQLHLITDEKLRTIATETLARRQIFSD
FT                   RMYELLDICERYGGLTDAEAEEFVQEARDSFRWHASAAVPYDDYMRLLRDNSVLADIVA
FT                   FRSPHINHLTPRTLDIDEVQSDMLNQGIPLKEYVEGPPKRKCPILLRQTSFKAIEEAIE
FT                   FPNGNKCDPRVLPSAVSGYHTARFGEVEQRGVALTIKGRQMYDSMLQSALQDGITAAHG
FT                   DAYSLKFARFPDSWEELRAEGLAWFQYRVDWDQLQSSETPKSDDLEYLIRSGYVVYEPI
FT                   VYEDFLPISAAGIFQSNLAKPGTTNGGSPKMVPCSNRREFELALGAATMDEMILYKNIQ
FT                   EESLLKCRQCVQDLKLGAATRQENSM"
     MKSETTSRHH AAPAKIRDAF SRAMSAMYAS EVPLYGRLLS LVSRVNKTTL EQDGLLRQRL        60
     EATDDLDRID MERHGAIRVG TPAELHSVRR VLHVMNMLPT GFYDLSAAGV PVYATCFRPH       120
     SASELSKNPF RLFVSLLQLH LITDEKLRTI ATETLARRQI FSDRMYELLD ICERYGGLTD       180
     AEAEEFVQEA RDSFRWHASA AVPYDDYMRL LRDNSVLADI VAFRSPHINH LTPRTLDIDE       240
     VQSDMLNQGI PLKEYVEGPP KRKCPILLRQ TSFKAIEEAI EFPNGNKCDP RVLPSAVSGY       300
     HTARFGEVEQ RGVALTIKGR QMYDSMLQSA LQDGITAAHG DAYSLKFARF PDSWEELRAE       360
     GLAWFQYRVD WDQLQSSETP KSDDLEYLIR SGYVVYEPIV YEDFLPISAA GIFQSNLAKP       420
     GTTNGGSPKM VPCSNRREFE LALGAATMDE MILYKNIQEE SLLKCRQCVQ DLKLGAATRQ       480
     ENSM                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page