(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE243

PENCW_16.PE243       Location/Qualifiers
FT   CDS             join(complement(552323..552784),complement(550833..552217),
FT                   complement(548826..550761))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158982" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824375"
FT                   /orf_name="Pc20g02430"
FT                   /product="Pc20g02430 protein"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85572.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI0001831839"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE5"
FT                   /transl_table=1
FT                   /translation="MDLPRARQDGLHNADRRARELYRYYKPASQAEVVPTWLPANDGFP
FT                   FTANSGNIITPPISEGSVPSHSPPSRPASAGSEALVLGTSNSTMTSFAQLAALRLNAER
FT                   VFVSVLDRDQQHIIAEATKSVNLNDPSIHDDNDNIWLGTSDTRKAWSVCKDIVSLPPND
FT                   RKNADYQFLIVNDMTENERYKHLSFVEKDPNFRFFAGTPLTTERNINLGCFFVLDKKPR
FT                   DGLTPLEKDTLGSISMLVMDYLRVCRQASEGRRAARLSRGLSYFVEGSSSFVDNVDPSR
FT                   TDSVGHLSATPASSYNRISASSRSHGDGSENASQAPSNSPPNDRSLSNDARSFSSVPSD
FT                   LKLDYDWKLGSGSKLDNGSNVESGTVESSLPEWLTSSSRNRLPPDDSQGTSWSFRRAAN
FT                   LLRESLDLSGDGGVIFLEANNSPLMDADMGGDCSDTGGPASVLSASTNEEPFAPQAGSM
FT                   TTCPAANLDRSFLQLLLRRYPKGKLWSFHRDGLISTSDDDDQEAQDKGPLGTSATSRSP
FT                   PNAQPSKPTRKRRKAAENSVLNQYFPHAAQIMFVPLWDAVSSQWFGGCFCWSTIETQVF
FT                   TTSVELSSVLGFSSSIMAEYSRVESLIADRQKGDFIGSISHELRSPLHGILAAAEFLNS
FT                   THLNEFQDSLLETINSCGRTLLDTMNQVLDFSKVVSLERTWRSMKRKKESQLDYKGSDK
FT                   LPHHLDTLVATDVAILAEEVVEGICLGNVYGQSSTASADLPVLMPHQTKSQHQRSNVEV
FT                   VIDVPFRDWVYRTQPGALRRIIMNIFGNAMKYTEFGRVTLSLAASSQSEGRSRRQGLED
FT                   LVTLTVTDTGKGISEEFLRGKLYTPFAQEDALAVGTGLGLSIVRSLVKALNGSIRIRSR
FT                   PGEGTVVRVSLPLERPVGKESPEIEPSGQLMQQRETLTQTLLLREGYLGRRASIWGIDP
FT                   SEVTANSNWSEIARYLSEWYDIEIVAWTPDAHIDLVLMDENDLPNFRTIAPSATLPALL
FT                   VLCHKSVDYTGSKSEWLSLANSVNIIRRPCGPHKLARSVMRCLTHGQPRSTTPASALQP
FT                   LNLPIRTSSLPSELASPHMSTGDDIGAPEQDCPGGRPMTVSPLRQPSPMTALKEEISEA
FT                   PLPDPLVEGAKPSRRLARVLVVDDNRINLNLMMTFLKKRQLTDLDPAENGKLAVEAVER
FT                   MQSGYDIIFMDMSMPVMNGFEATRAIRSLERDTDGRKPAIIIALTGLSSSRDESDAIAS
FT                   GVDLFLTKPVSFREVARLLNEWERGELVTERKMTC"
     MDLPRARQDG LHNADRRARE LYRYYKPASQ AEVVPTWLPA NDGFPFTANS GNIITPPISE        60
     GSVPSHSPPS RPASAGSEAL VLGTSNSTMT SFAQLAALRL NAERVFVSVL DRDQQHIIAE       120
     ATKSVNLNDP SIHDDNDNIW LGTSDTRKAW SVCKDIVSLP PNDRKNADYQ FLIVNDMTEN       180
     ERYKHLSFVE KDPNFRFFAG TPLTTERNIN LGCFFVLDKK PRDGLTPLEK DTLGSISMLV       240
     MDYLRVCRQA SEGRRAARLS RGLSYFVEGS SSFVDNVDPS RTDSVGHLSA TPASSYNRIS       300
     ASSRSHGDGS ENASQAPSNS PPNDRSLSND ARSFSSVPSD LKLDYDWKLG SGSKLDNGSN       360
     VESGTVESSL PEWLTSSSRN RLPPDDSQGT SWSFRRAANL LRESLDLSGD GGVIFLEANN       420
     SPLMDADMGG DCSDTGGPAS VLSASTNEEP FAPQAGSMTT CPAANLDRSF LQLLLRRYPK       480
     GKLWSFHRDG LISTSDDDDQ EAQDKGPLGT SATSRSPPNA QPSKPTRKRR KAAENSVLNQ       540
     YFPHAAQIMF VPLWDAVSSQ WFGGCFCWST IETQVFTTSV ELSSVLGFSS SIMAEYSRVE       600
     SLIADRQKGD FIGSISHELR SPLHGILAAA EFLNSTHLNE FQDSLLETIN SCGRTLLDTM       660
     NQVLDFSKVV SLERTWRSMK RKKESQLDYK GSDKLPHHLD TLVATDVAIL AEEVVEGICL       720
     GNVYGQSSTA SADLPVLMPH QTKSQHQRSN VEVVIDVPFR DWVYRTQPGA LRRIIMNIFG       780
     NAMKYTEFGR VTLSLAASSQ SEGRSRRQGL EDLVTLTVTD TGKGISEEFL RGKLYTPFAQ       840
     EDALAVGTGL GLSIVRSLVK ALNGSIRIRS RPGEGTVVRV SLPLERPVGK ESPEIEPSGQ       900
     LMQQRETLTQ TLLLREGYLG RRASIWGIDP SEVTANSNWS EIARYLSEWY DIEIVAWTPD       960
     AHIDLVLMDE NDLPNFRTIA PSATLPALLV LCHKSVDYTG SKSEWLSLAN SVNIIRRPCG      1020
     PHKLARSVMR CLTHGQPRST TPASALQPLN LPIRTSSLPS ELASPHMSTG DDIGAPEQDC      1080
     PGGRPMTVSP LRQPSPMTAL KEEISEAPLP DPLVEGAKPS RRLARVLVVD DNRINLNLMM      1140
     TFLKKRQLTD LDPAENGKLA VEAVERMQSG YDIIFMDMSM PVMNGFEATR AIRSLERDTD      1200
     GRKPAIIIAL TGLSSSRDES DAIASGVDLF LTKPVSFREV ARLLNEWERG ELVTERKMTC      1260
//

If you have problems or comments...

PBIL Back to PBIL home page