(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE244

PENCW_16.PE244       Location/Qualifiers
FT   CDS             join(complement(555544..555774),complement(555376..555487),
FT                   complement(555055..555317),complement(554662..555004),
FT                   complement(554541..554603),complement(554286..554490),
FT                   complement(553864..554215))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200355" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947802"
FT                   /orf_name="Pc20g02440"
FT                   /product="Pc20g02440 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85573.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183183A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE6"
FT                   /transl_table=1
FT                   /translation="MADDTSDSKSVDVVSAPVREDIKTPSEEPSDNSDDSDGRKPPPLA
FT                   AKLCAVALISCISFGSHWSSGVTGAMKSTMKKEMHIDNVQFSLLEASEDFMATVLLLIS
FT                   GVITDRVGGAQMIVYGNIVYTIGSILVAAAATVRSFDFMIGGRIILALGDIATQIAQYK
FT                   MFSSWFPPSNGFASTLGFELAIGKIGGFIGKSTSNIIASKTGNFAWVFWTAVFMNLFTN
FT                   AASAAFWFFNIYCNRHYKGRRDEATKEQLTEKNKKFEFKKMFELPWMFWAVMGFSIFQT
FT                   SAASVFSQNATELAEKRFNVDSIKAGWYSSLSQYAGFFLVPCLGVFIDVLGNRASVLFI
FT                   CGLGMLLSMVLINFATSHAGTGAAFGIYGIAVSFGPTSVIDSIRTTLWHQSVFGSAYAL
FT                   KVTMNNAMSIIIRIITGALQDADDNSYRRVVQVYLVLGAGATVVGAAILIGSFVTDNLA
FT                   PLQWTRHKRLTSGAAVIERIRERSLVTQRERTRKISILCFAALLLLTVGSWVAYIWGAV
FT                   TGHNS"
     MADDTSDSKS VDVVSAPVRE DIKTPSEEPS DNSDDSDGRK PPPLAAKLCA VALISCISFG        60
     SHWSSGVTGA MKSTMKKEMH IDNVQFSLLE ASEDFMATVL LLISGVITDR VGGAQMIVYG       120
     NIVYTIGSIL VAAAATVRSF DFMIGGRIIL ALGDIATQIA QYKMFSSWFP PSNGFASTLG       180
     FELAIGKIGG FIGKSTSNII ASKTGNFAWV FWTAVFMNLF TNAASAAFWF FNIYCNRHYK       240
     GRRDEATKEQ LTEKNKKFEF KKMFELPWMF WAVMGFSIFQ TSAASVFSQN ATELAEKRFN       300
     VDSIKAGWYS SLSQYAGFFL VPCLGVFIDV LGNRASVLFI CGLGMLLSMV LINFATSHAG       360
     TGAAFGIYGI AVSFGPTSVI DSIRTTLWHQ SVFGSAYALK VTMNNAMSII IRIITGALQD       420
     ADDNSYRRVV QVYLVLGAGA TVVGAAILIG SFVTDNLAPL QWTRHKRLTS GAAVIERIRE       480
     RSLVTQRERT RKISILCFAA LLLLTVGSWV AYIWGAVTGH NS                          522
//

If you have problems or comments...

PBIL Back to PBIL home page