(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE245

PENCW_16.PE245       Location/Qualifiers
FT   CDS             join(complement(558518..558706),complement(558369..558453),
FT                   complement(557993..558306),complement(557679..557897),
FT                   complement(557428..557624),complement(556632..557376))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824376"
FT                   /orf_name="Pc20g02450"
FT                   /product="Pc20g02450 protein"
FT                   /protein_id="CAP85574.1"
FT                   /db_xref="InterPro:IPR010573"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000183183B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE7"
FT                   /transl_table=1
FT                   /translation="MGSLSTTGNEDGKGLQVDHLETANMAHQEQHVETDRAPEAMGREQ
FT                   AELPKGYFYSPYFIGSYCAIGVAFACGTGGYALVAPILTDINNDLGGSGSSDINWVGIV
FT                   YSLTQAIVLMLAGRLSDLFGRRWFFVIGSVIGLVGSIVGARAGTIGQLIAGETLIGIAA
FT                   GFQCSFFWIVSEIVPMKRRFIANSGLFLWTLPTNNTAVQWRGCFYYLTGLNALSVALWF
FT                   FFYHPPSFHMLHRDKTVKQMVLEFDFIGLVLFSAGMILFLIGLNWGGSIYPWKSGQVLG
FT                   TLLSGVAILAVCIAYELKSSLKEPYLPLQLFKNVKYTSCVVWCAIEAMNFYAFGIIWPR
FT                   AVAILYPSLSPASSATMSGLVTMSFALGQMAGPFFANWLPAKPLVIVGTFIGTGLLAAC
FT                   AANPLNLDLTVGVLVTGNLVIGMADGIGLPMTTFPIKNQEALGTAGGLSGCIRLAGTSV
FT                   AVAMYNTILNNRLLQTIPAAVTPVALSAGVPESFIPQLIANLTRTNRVGGGIPGLTAGD
FT                   VPLIQSAFQLGNSQAYSTVFLSTLGFGGVALILCFLIGGVDESNGEYVAALIQHGDGSD
FT                   QQTEKV"
     MGSLSTTGNE DGKGLQVDHL ETANMAHQEQ HVETDRAPEA MGREQAELPK GYFYSPYFIG        60
     SYCAIGVAFA CGTGGYALVA PILTDINNDL GGSGSSDINW VGIVYSLTQA IVLMLAGRLS       120
     DLFGRRWFFV IGSVIGLVGS IVGARAGTIG QLIAGETLIG IAAGFQCSFF WIVSEIVPMK       180
     RRFIANSGLF LWTLPTNNTA VQWRGCFYYL TGLNALSVAL WFFFYHPPSF HMLHRDKTVK       240
     QMVLEFDFIG LVLFSAGMIL FLIGLNWGGS IYPWKSGQVL GTLLSGVAIL AVCIAYELKS       300
     SLKEPYLPLQ LFKNVKYTSC VVWCAIEAMN FYAFGIIWPR AVAILYPSLS PASSATMSGL       360
     VTMSFALGQM AGPFFANWLP AKPLVIVGTF IGTGLLAACA ANPLNLDLTV GVLVTGNLVI       420
     GMADGIGLPM TTFPIKNQEA LGTAGGLSGC IRLAGTSVAV AMYNTILNNR LLQTIPAAVT       480
     PVALSAGVPE SFIPQLIANL TRTNRVGGGI PGLTAGDVPL IQSAFQLGNS QAYSTVFLST       540
     LGFGGVALIL CFLIGGVDES NGEYVAALIQ HGDGSDQQTE KV                          582
//

If you have problems or comments...

PBIL Back to PBIL home page