(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE246

PENCW_16.PE246       Location/Qualifiers
FT   CDS             join(complement(560424..560496),complement(560196..560343),
FT                   complement(560049..560126),complement(559865..559946),
FT                   complement(559352..559801))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15947803"
FT                   /orf_name="Pc20g02460"
FT                   /product="Pc20g02460 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85575.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000183183C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE8"
FT                   /transl_table=1
FT                   /translation="MASQSAIQESLQSYKTTSTVDDFHSGGDGIGLALVKAVVEFGGHV
FT                   AVIDYREVPHLDLCEIQDLHKESRVKYFSVDITNEMLVTKAFDGILAEFGRIDGVIACA
FT                   GVCVEKPFVDHTWEEVVRLQMVNSVGLFFAVQLAVKAMLKNQPTSGDFTPKGSVILIGS
FT                   IATESGVESQGLTAYSASKGAANGLLRGLAVELAPMGIRVNMISPGHTVTDMSISQFTN
FT                   RPELAMIMRNAVPMGRMGDRRDLKGAAVYFLSDASLYTTGSNLVISGGLHAGRL"
     MASQSAIQES LQSYKTTSTV DDFHSGGDGI GLALVKAVVE FGGHVAVIDY REVPHLDLCE        60
     IQDLHKESRV KYFSVDITNE MLVTKAFDGI LAEFGRIDGV IACAGVCVEK PFVDHTWEEV       120
     VRLQMVNSVG LFFAVQLAVK AMLKNQPTSG DFTPKGSVIL IGSIATESGV ESQGLTAYSA       180
     SKGAANGLLR GLAVELAPMG IRVNMISPGH TVTDMSISQF TNRPELAMIM RNAVPMGRMG       240
     DRRDLKGAAV YFLSDASLYT TGSNLVISGG LHAGRL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page