(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE247

PENCW_16.PE247       Location/Qualifiers
FT   CDS             560857..561303
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128705"
FT                   /orf_name="Pc20g02470"
FT                   /product="Pc20g02470 protein"
FT                   /protein_id="CAP85576.1"
FT                   /db_xref="UniParc:UPI000183183D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE9"
FT                   /transl_table=1
FT                   /translation="MGTKKFTAREVLDAFYKAEREYMQATPEQRDYASIAATLAPNVRM
FT                   EQTSALPYAGVYIGPDGMQDWTRRMADYFEVVDVQNPEIFERAGSEKIVVLSNVHFKVR
FT                   KTGKEMDFPFCQAITVDLERGVIVELRPFYWDVAEVNKSLGYAP"
     MGTKKFTARE VLDAFYKAER EYMQATPEQR DYASIAATLA PNVRMEQTSA LPYAGVYIGP        60
     DGMQDWTRRM ADYFEVVDVQ NPEIFERAGS EKIVVLSNVH FKVRKTGKEM DFPFCQAITV       120
     DLERGVIVEL RPFYWDVAEV NKSLGYAP                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page