(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE248

PENCW_16.PE248       Location/Qualifiers
FT   CDS             561986..563425
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824377"
FT                   /orf_name="Pc20g02480"
FT                   /product="Pc20g02480 protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85577.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000183183E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG4"
FT                   /transl_table=1
FT                   /translation="MSLAFNTDSVVPLWLNGAQRVTKTTFDVVSPVSHQALWKASAADE
FT                   GDVEDAIASAATAFETWRWTKPQERREIFLRAYELLKERRDQSMAYSTAETGVPPVMFG
FT                   VEYNGAIDICLQLAGLSAHYGTVVDPDANDTSAVVISQPYGVVLGIGPWNAPHTLGMRA
FT                   CLFPLAAGNTVILKGPEMAPATYWHFVSILHEAGLPAGCLNTIYHRPSDAAAITKQLIS
FT                   HPAIRKVNFTGSTAVGSVIAGLCGQYIKPCLLELGGKASVIVCEDANLELAAEQCALGA
FT                   FSHAGQVCMSTERIIVHDTVADRFRPILKAAIDRIFGEGQPASILINETAAAKVRGLVQ
FT                   DAVTKGANLLYGSLSDGSEGVNRLLPVVVEDVQPGMDIYYNESFGPSVSLYTFTDDEQA
FT                   LKLANDTAYGLTGAVFTEDLRRGLSLAKRLETGAVHINNMTAHDEASLPHGGVKDSGFG
FT                   RFNGPDGLREWVKTKSITWRD"
     MSLAFNTDSV VPLWLNGAQR VTKTTFDVVS PVSHQALWKA SAADEGDVED AIASAATAFE        60
     TWRWTKPQER REIFLRAYEL LKERRDQSMA YSTAETGVPP VMFGVEYNGA IDICLQLAGL       120
     SAHYGTVVDP DANDTSAVVI SQPYGVVLGI GPWNAPHTLG MRACLFPLAA GNTVILKGPE       180
     MAPATYWHFV SILHEAGLPA GCLNTIYHRP SDAAAITKQL ISHPAIRKVN FTGSTAVGSV       240
     IAGLCGQYIK PCLLELGGKA SVIVCEDANL ELAAEQCALG AFSHAGQVCM STERIIVHDT       300
     VADRFRPILK AAIDRIFGEG QPASILINET AAAKVRGLVQ DAVTKGANLL YGSLSDGSEG       360
     VNRLLPVVVE DVQPGMDIYY NESFGPSVSL YTFTDDEQAL KLANDTAYGL TGAVFTEDLR       420
     RGLSLAKRLE TGAVHINNMT AHDEASLPHG GVKDSGFGRF NGPDGLREWV KTKSITWRD        479
//

If you have problems or comments...

PBIL Back to PBIL home page