(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE250

PENCW_16.PE250       Location/Qualifiers
FT   CDS             join(complement(568164..568259),complement(568007..568110),
FT                   complement(567701..567942),complement(566849..567638),
FT                   complement(566113..566630),complement(565859..566065),
FT                   complement(565592..565788))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977595"
FT                   /orf_name="Pc20g02500"
FT                   /product="Pc20g02500 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85579.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831915"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG6"
FT                   /transl_table=1
FT                   /translation="MLANPAVPATEQQPKRRRVTLACISCRARKSRCSGQRPKCSTCTE
FT                   LGLTCQYVSSGQTDQTVVVGKEHFQTIEERLHHLESLLDQGRASSKRSWSDVDTPDIDN
FT                   QPALTPNLVSTSDGPLTGSIGSDDPTDGMGHFVIAHEEHRAYFGPSSNIAFASELSRTL
FT                   KRLSRSRGEFSPGSKQTTLRDFHIARVSRPSSPMSQSATWAPNNHQQDAATSSIFYLPP
FT                   DQETSVLIDQYFGNTGLLFPYIHEDTFRESYAQLRQNSAGTRRTWLGVLNMVLAMATHT
FT                   TTLPMGKVDKRQAQSEAFYARADGLCSQHVMNGASLEIGQLLVFLSICPGHELFDAIVR
FT                   DIDRKTVQYLLLVSQYMQGTRSSIQTWATHGLAVKVALQLGLHSVEASRRFSPVEREVR
FT                   KRTWFGCIVLDRYPVKETRIGRSDCQGNSQDCSRLYSIMGNAIDLLYDGNLGSEDKILN
FT                   YELITRVLRMRHSLEEWIEQLPAHMRLIRAENCAAELGKDPTNDRFRTILTLRYHNLQV
FT                   LIHRAVLLRLCDYQDQNILALQDIAWSTEQITIESATEIINIVRFVVEAGLVQQGLLGA
FT                   WWFTLYYMFDAALILFTILLVKRFSSIKLYPPTTLDSIKEVFLSCIEPLRRLDEGNRTV
FT                   DKCCRCLQALSEVWNSIEINNEESLAQDIPLLTQPRDYNYHHDNSVVGQEFADQSLSFL
FT                   DFDLMANELFDVTDGLVPGWGVQ"
     MLANPAVPAT EQQPKRRRVT LACISCRARK SRCSGQRPKC STCTELGLTC QYVSSGQTDQ        60
     TVVVGKEHFQ TIEERLHHLE SLLDQGRASS KRSWSDVDTP DIDNQPALTP NLVSTSDGPL       120
     TGSIGSDDPT DGMGHFVIAH EEHRAYFGPS SNIAFASELS RTLKRLSRSR GEFSPGSKQT       180
     TLRDFHIARV SRPSSPMSQS ATWAPNNHQQ DAATSSIFYL PPDQETSVLI DQYFGNTGLL       240
     FPYIHEDTFR ESYAQLRQNS AGTRRTWLGV LNMVLAMATH TTTLPMGKVD KRQAQSEAFY       300
     ARADGLCSQH VMNGASLEIG QLLVFLSICP GHELFDAIVR DIDRKTVQYL LLVSQYMQGT       360
     RSSIQTWATH GLAVKVALQL GLHSVEASRR FSPVEREVRK RTWFGCIVLD RYPVKETRIG       420
     RSDCQGNSQD CSRLYSIMGN AIDLLYDGNL GSEDKILNYE LITRVLRMRH SLEEWIEQLP       480
     AHMRLIRAEN CAAELGKDPT NDRFRTILTL RYHNLQVLIH RAVLLRLCDY QDQNILALQD       540
     IAWSTEQITI ESATEIINIV RFVVEAGLVQ QGLLGAWWFT LYYMFDAALI LFTILLVKRF       600
     SSIKLYPPTT LDSIKEVFLS CIEPLRRLDE GNRTVDKCCR CLQALSEVWN SIEINNEESL       660
     AQDIPLLTQP RDYNYHHDNS VVGQEFADQS LSFLDFDLMA NELFDVTDGL VPGWGVQ          717
//

If you have problems or comments...

PBIL Back to PBIL home page