(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE252

PENCW_16.PE252       Location/Qualifiers
FT   CDS             join(570487..570734,570769..570952,571026..571395,
FT                   571456..571565)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671681"
FT                   /orf_name="Pc20g02520"
FT                   /product="Pc20g02520 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP85581.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI0001831917"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG8"
FT                   /transl_table=1
FT                   /translation="MRVAWQRFIRFQAADGRILQGEPILSKPDLDLGYVTEKDRLQARV
FT                   IVGDDILDETGVTRVSDEIVTVRRILSPLAPSDVPTIRGKSTNLQELSELITAVQQAKR
FT                   TPPPFPFIFFKPQTTILDHGDNVVIPKIAQDDQADYEGELTIVIGKDAKDVSQENALDY
FT                   VAAYTVGNDISSRKLQRDPEYAGRIPQWGFSKGFDTYAPIGPCLLASSLVDDPKNLHLT
FT                   TIVDGDVRQDESVDDLLFDCRYLISYLSQGTTLQKGSIIMTGTPGGVGGDMKPPRWLQP
FT                   GTQMEVRISKIGTLRNGVVFAE"
     MRVAWQRFIR FQAADGRILQ GEPILSKPDL DLGYVTEKDR LQARVIVGDD ILDETGVTRV        60
     SDEIVTVRRI LSPLAPSDVP TIRGKSTNLQ ELSELITAVQ QAKRTPPPFP FIFFKPQTTI       120
     LDHGDNVVIP KIAQDDQADY EGELTIVIGK DAKDVSQENA LDYVAAYTVG NDISSRKLQR       180
     DPEYAGRIPQ WGFSKGFDTY APIGPCLLAS SLVDDPKNLH LTTIVDGDVR QDESVDDLLF       240
     DCRYLISYLS QGTTLQKGSI IMTGTPGGVG GDMKPPRWLQ PGTQMEVRIS KIGTLRNGVV       300
     FAE                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page