(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE257

PENCW_16.PE257       Location/Qualifiers
FT   CDS             join(580904..581000,581196..582564,582617..583673)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947807"
FT                   /orf_name="Pc20g02570"
FT                   /product="Pc20g02570 protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAP85586.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI000183191C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH3"
FT                   /transl_table=1
FT                   /translation="MARLMGSRMMRSRSREAANPGFMPNKGSLERNWLTGVTEEPSTPS
FT                   PGFIAPRHVVPESPENHEGHTNVSGTTLGHNDVEPVGSQVADKIATHLPFVQQQATLVM
FT                   SLLVRPELNPDSLAAESKRLLDSNHPNRKRLRRSVEGLTDELEDSPLSRDGRSFLDISQ
FT                   ARRLLSPAQLDASIAYIYMTNCALLTLNMFLPSMGIESQSEVMQQLDSQFPGCVMSNLV
FT                   ESSMTRDIGASNTTETTFNLALGIRTQFFIMELERRQHEQDFNPLSILRQIFAMDLAPS
FT                   EDDSPASFRGFNLPGVLQDEDGHLPEYLPERFLIAISDRFNELHEEISEWDSLDIDGLR
FT                   KAYRWRSFERDLARWVYARDREIKDDIRRLSERLRISPSPRRLTSVPAGTPNRRPGSTV
FT                   PPSGDISRPRPLPQQTHSPQKERLVNAPGANRAPQAETVVQAEQSAQAGNIPGDIASRS
FT                   GITSQTVPEQSVSNQVAQTVSKDPGRRKSKSNYRDPASLAALMRRQATSRPQPASNVAS
FT                   QAQNISTGTNIVTQADPSANRGVDSVEIQQSPDMTYRDIGDESTYVNNDEDLDLGQGPE
FT                   PDVMTSTSPPTSSRIGRVSHNPNPRFFDSPRDGNTQRSVPAARRFLDKQSNARVVSPIS
FT                   QYDAPSPGNQFTVLGKRNRNADPPDDDLSDESDVEFEQNNQDLDPRRRVEKPQQKLPAA
FT                   KRQRPEDNAGSVGERLPSSINQSFRHNQPISTQGAQRVQRAESDDITDDETAVEQYEAP
FT                   TRTQGPWAASNSQAALVNRRVRGATHRWTEEEDERLIYLLGIYGTSYSAIKKQDNACPP
FT                   SEGGPMLERRSQVNCKDRARNLKKKYLR"
     MARLMGSRMM RSRSREAANP GFMPNKGSLE RNWLTGVTEE PSTPSPGFIA PRHVVPESPE        60
     NHEGHTNVSG TTLGHNDVEP VGSQVADKIA THLPFVQQQA TLVMSLLVRP ELNPDSLAAE       120
     SKRLLDSNHP NRKRLRRSVE GLTDELEDSP LSRDGRSFLD ISQARRLLSP AQLDASIAYI       180
     YMTNCALLTL NMFLPSMGIE SQSEVMQQLD SQFPGCVMSN LVESSMTRDI GASNTTETTF       240
     NLALGIRTQF FIMELERRQH EQDFNPLSIL RQIFAMDLAP SEDDSPASFR GFNLPGVLQD       300
     EDGHLPEYLP ERFLIAISDR FNELHEEISE WDSLDIDGLR KAYRWRSFER DLARWVYARD       360
     REIKDDIRRL SERLRISPSP RRLTSVPAGT PNRRPGSTVP PSGDISRPRP LPQQTHSPQK       420
     ERLVNAPGAN RAPQAETVVQ AEQSAQAGNI PGDIASRSGI TSQTVPEQSV SNQVAQTVSK       480
     DPGRRKSKSN YRDPASLAAL MRRQATSRPQ PASNVASQAQ NISTGTNIVT QADPSANRGV       540
     DSVEIQQSPD MTYRDIGDES TYVNNDEDLD LGQGPEPDVM TSTSPPTSSR IGRVSHNPNP       600
     RFFDSPRDGN TQRSVPAARR FLDKQSNARV VSPISQYDAP SPGNQFTVLG KRNRNADPPD       660
     DDLSDESDVE FEQNNQDLDP RRRVEKPQQK LPAAKRQRPE DNAGSVGERL PSSINQSFRH       720
     NQPISTQGAQ RVQRAESDDI TDDETAVEQY EAPTRTQGPW AASNSQAALV NRRVRGATHR       780
     WTEEEDERLI YLLGIYGTSY SAIKKQDNAC PPSEGGPMLE RRSQVNCKDR ARNLKKKYLR       840
//

If you have problems or comments...

PBIL Back to PBIL home page