(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE258

PENCW_16.PE258       Location/Qualifiers
FT   CDS             join(584958..585211,585247..585420,585472..585535,
FT                   585699..586937)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671682"
FT                   /orf_name="Pc20g02580"
FT                   /product="Pc20g02580 protein"
FT                   /protein_id="CAP85587.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000183191D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH4"
FT                   /transl_table=1
FT                   /translation="MGNGKGKNKGKGRGKKRSRSLKENKVAAKVEIKPEDKIEDKIEIK
FT                   GKHHCLRKRPTHAPTSRCLRLGHVVQCPIHPNSFPRRLSDATGAQGQKEVEQQLISFFW
FT                   SFKVDRACQRTLLDICLLLLWLCYVGLYILASYYSTEERFIFLSIPDFGEKLHIEQYKG
FT                   YRRHSVCAHNNHPMWKNTKPRHLAFRAHHRHVITCLQFDADKIIVGSDNTHINVYDTKT
FT                   GALRAKLEGHEGGVWALEYHDNTLVSASTDRTIRVWDIAKAKCTHVFQGHTSTVRCMKI
FT                   LLPVQIDQHERPQIISGSRDSTMRIWKLPQPGDSEYFPPTESVEECPYLIRVLTGHQHS
FT                   VRAIAAYGDTVVSGSYDCTVRVWKISTGESLHCLQGHTFKVYNVCLDHERNRCISGSMD
FT                   STVKIWSLDTGALLYNLEGHSSLVGLLDLKEDLLVSASADSTLRVWNPANGHCQSTLGS
FT                   HTGAITCFQHDGQKIISGSDASLKMWDTRTGVFERDLLTDLSGTWQVQFDTQHCVAAAQ
FT                   RGDVSYIEVSTHPTDIPSIYNLLFMKILDFGASPETIPSGQFGKRVLVDELGNEIESPK
FT                   "
     MGNGKGKNKG KGRGKKRSRS LKENKVAAKV EIKPEDKIED KIEIKGKHHC LRKRPTHAPT        60
     SRCLRLGHVV QCPIHPNSFP RRLSDATGAQ GQKEVEQQLI SFFWSFKVDR ACQRTLLDIC       120
     LLLLWLCYVG LYILASYYST EERFIFLSIP DFGEKLHIEQ YKGYRRHSVC AHNNHPMWKN       180
     TKPRHLAFRA HHRHVITCLQ FDADKIIVGS DNTHINVYDT KTGALRAKLE GHEGGVWALE       240
     YHDNTLVSAS TDRTIRVWDI AKAKCTHVFQ GHTSTVRCMK ILLPVQIDQH ERPQIISGSR       300
     DSTMRIWKLP QPGDSEYFPP TESVEECPYL IRVLTGHQHS VRAIAAYGDT VVSGSYDCTV       360
     RVWKISTGES LHCLQGHTFK VYNVCLDHER NRCISGSMDS TVKIWSLDTG ALLYNLEGHS       420
     SLVGLLDLKE DLLVSASADS TLRVWNPANG HCQSTLGSHT GAITCFQHDG QKIISGSDAS       480
     LKMWDTRTGV FERDLLTDLS GTWQVQFDTQ HCVAAAQRGD VSYIEVSTHP TDIPSIYNLL       540
     FMKILDFGAS PETIPSGQFG KRVLVDELGN EIESPK                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page