(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE259

PENCW_16.PE259       Location/Qualifiers
FT   CDS             588003..591038
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128708"
FT                   /orf_name="Pc20g02590"
FT                   /product="Pc20g02590 protein"
FT                   /function="L-aminoadipate-semialdehyde dehydrogenase
FT                   activity"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /protein_id="CAP85588.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0004043"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000183191E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH5"
FT                   /transl_table=1
FT                   /translation="MEQLLCNRANEASNALAVIDGDHRFTYRDLLAKADILAADLLKKG
FT                   LGTEEPVGIVVGPGWQQIIARVAVLRAGGTSVPIDPSAPDIQLHAMLGDLSTRFVMTTN
FT                   NLAGKVSQFNILPIETVLDPEYQTEKHGEINAMSGKSEGHRSHILHTSGSTGKPKAVQI
FT                   SSKAVLHLAASLPVDIGEGDKVGQLNNPGFDLSLFEVWVTLLSGGTVVHIPKSIIKDPV
FT                   SFAAFLKDTGLTALILPCALFTAVSASTPSAFQSVRHVVSAGESPSPQAMQKVLSSDGP
FT                   PENLWNGYGPTETTCLSTLQRVTLEEAECGPISAGVPFGDTVLHLLDEAQKPIVDDEIP
FT                   GEICIGGPGLSAGYLNHTEANAEKFIRIEVADSQDPRRVKITRLYRTGDIGMWKGLPKR
FT                   LQYIGRVDLQVKHQGFRVELEAIEQTIAANDSIRAVACLHQKAGDGPGLDRLIAVVAPA
FT                   NDMPLDPQKIIEWTQNRHPYYMVPNQVRVVSEIPLNSRGKVDRDALHKEIKESRPLKST
FT                   QDNAKDESSLAKVTKILEENLGLSNIGPDDNIISLGLSSLQVARFLGLIKQKIGKLISI
FT                   KDLYINPSIRSLVHHLHQADETNYGPSEVLQFEADAHLADDIELIPDWTSEGRVFLTGA
FT                   TGFIGVNLLYRWLSRPSMKEVEIACLARGNENYSPMDRIKNALKKYDLWSEDISQEMKR
FT                   VIVLDGDMTQERLGLPHSDYQWLINWAPAVFHAAAKVNWCDSYNGHFAQNVQGTKNVLR
FT                   VAAEGRRKTMHYISSIDVWAVTGLILGTDVVSEDGPLKVHLASLPFDTGYAQSQWVADE
FT                   MVQRVRDKGLPVTIYRPGFVVGDSKTGAGNPDDFFGRLIAGCIQLGYWPHMPHQNQEYV
FT                   TVDYVCDSIIRIASDNRNIGHAYTLSSPNPGQITNMERLCVLINQAGFSVQEIPYAEWL
FT                   EKMQAWDGFESSPCLPLMPLLAEPILRGDTRLQTSKYSPRYDCANTLKAIGACDDIRFV
FT                   QLTPDLVKKYIDFWARKGFYNF"
     MEQLLCNRAN EASNALAVID GDHRFTYRDL LAKADILAAD LLKKGLGTEE PVGIVVGPGW        60
     QQIIARVAVL RAGGTSVPID PSAPDIQLHA MLGDLSTRFV MTTNNLAGKV SQFNILPIET       120
     VLDPEYQTEK HGEINAMSGK SEGHRSHILH TSGSTGKPKA VQISSKAVLH LAASLPVDIG       180
     EGDKVGQLNN PGFDLSLFEV WVTLLSGGTV VHIPKSIIKD PVSFAAFLKD TGLTALILPC       240
     ALFTAVSAST PSAFQSVRHV VSAGESPSPQ AMQKVLSSDG PPENLWNGYG PTETTCLSTL       300
     QRVTLEEAEC GPISAGVPFG DTVLHLLDEA QKPIVDDEIP GEICIGGPGL SAGYLNHTEA       360
     NAEKFIRIEV ADSQDPRRVK ITRLYRTGDI GMWKGLPKRL QYIGRVDLQV KHQGFRVELE       420
     AIEQTIAAND SIRAVACLHQ KAGDGPGLDR LIAVVAPAND MPLDPQKIIE WTQNRHPYYM       480
     VPNQVRVVSE IPLNSRGKVD RDALHKEIKE SRPLKSTQDN AKDESSLAKV TKILEENLGL       540
     SNIGPDDNII SLGLSSLQVA RFLGLIKQKI GKLISIKDLY INPSIRSLVH HLHQADETNY       600
     GPSEVLQFEA DAHLADDIEL IPDWTSEGRV FLTGATGFIG VNLLYRWLSR PSMKEVEIAC       660
     LARGNENYSP MDRIKNALKK YDLWSEDISQ EMKRVIVLDG DMTQERLGLP HSDYQWLINW       720
     APAVFHAAAK VNWCDSYNGH FAQNVQGTKN VLRVAAEGRR KTMHYISSID VWAVTGLILG       780
     TDVVSEDGPL KVHLASLPFD TGYAQSQWVA DEMVQRVRDK GLPVTIYRPG FVVGDSKTGA       840
     GNPDDFFGRL IAGCIQLGYW PHMPHQNQEY VTVDYVCDSI IRIASDNRNI GHAYTLSSPN       900
     PGQITNMERL CVLINQAGFS VQEIPYAEWL EKMQAWDGFE SSPCLPLMPL LAEPILRGDT       960
     RLQTSKYSPR YDCANTLKAI GACDDIRFVQ LTPDLVKKYI DFWARKGFYN F               1011
//

If you have problems or comments...

PBIL Back to PBIL home page