(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE260

PENCW_16.PE260       Location/Qualifiers
FT   CDS             join(complement(591837..591941),complement(591529..591768))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824379"
FT                   /orf_name="Pc20g02600"
FT                   /product="Putative uncharacterized protein Pc20g02600 "
FT                   /protein_id="CAP85589.1"
FT                   /db_xref="UniParc:UPI000183191F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH6"
FT                   /transl_table=1
FT                   /translation="MPRLGLRGFAVVLAVIIMSLLGALFGNTGWVYYIVVGIPGIWSLA
FT                   NLALIVFKRPVHPGAHIALDFIFTIVQLFFGIISLLAEQVSSLYGSSLHSSHSSWSMAV
FT                   AAFALMVING"
     MPRLGLRGFA VVLAVIIMSL LGALFGNTGW VYYIVVGIPG IWSLANLALI VFKRPVHPGA        60
     HIALDFIFTI VQLFFGIISL LAEQVSSLYG SSLHSSHSSW SMAVAAFALM VING             114
//

If you have problems or comments...

PBIL Back to PBIL home page