(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE261

PENCW_16.PE261       Location/Qualifiers
FT   CDS             join(593413..593908,593965..595539,595632..595708)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183624" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947808"
FT                   /orf_name="Pc20g02610"
FT                   /product="Pc20g02610 protein"
FT                   /protein_id="CAP85590.1"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI0001831920"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH7"
FT                   /transl_table=1
FT                   /translation="MGNPEHDFSSKHTEAVSNTEAVSNHPPYSSITESIDEPPTYGQSN
FT                   ASYRVSHDGFPRSVVVVVDECITHLKLLSAIAKLRNFIKGTDKLFGIHDAEIRNFSNNQ
FT                   QAQAAARIREKRWAVYVARAVDRFTIWWQSYLPSLKTSHISTLNTASEANIAWSANMMP
FT                   PLDVIMVWHAFMLNPRAFLEDCLRQSKMSVWATGMPWDIINASIDDKTLVFYPDRDSEA
FT                   RINFEAITGHSWENIHDSPAKSLPCIGCKQEIIAPWTEGSIGCDTDVAFAHCTGYADKS
FT                   LRVSCPACKFNTTHDTLRVQKFRSDVQKLLKDDIPMPGTLLSQNGTPADDGNGDNVSFP
FT                   NRLIKEGIRSELLQLTDLTENESTTIETIRDHLEAYLKSRSVMRRVNKTILASGNSSMP
FT                   ERISLRNMLSRYWDNSSPFAIDLVGAVIRQGTFVDKMDNIGWVRSPNPRSTMGHFIGKY
FT                   GVFFQIMVKNKGHAVVPTLDVDLIWHTHQLSPIRYYIFSTTQMEGIFINHDDKIDETKL
FT                   NDAFAWTSRQYQKLTGGKIYSECTCWYCEAVRESNNQGLGRLISPSTLHAKTNAALLHN
FT                   SADNATDGKSKEPHISSHNAVRILAQADPKAMQTKTAQLESCWEKAQRRSHNRSRSRGG
FT                   GSAHGDPPRKTVYGPYARDPDIHREIYPCNPACVNITAGVVGNCMSGTQGVGLAQASQQ
FT                   MCKYLWTEPSVLQVSRELDNV"
     MGNPEHDFSS KHTEAVSNTE AVSNHPPYSS ITESIDEPPT YGQSNASYRV SHDGFPRSVV        60
     VVVDECITHL KLLSAIAKLR NFIKGTDKLF GIHDAEIRNF SNNQQAQAAA RIREKRWAVY       120
     VARAVDRFTI WWQSYLPSLK TSHISTLNTA SEANIAWSAN MMPPLDVIMV WHAFMLNPRA       180
     FLEDCLRQSK MSVWATGMPW DIINASIDDK TLVFYPDRDS EARINFEAIT GHSWENIHDS       240
     PAKSLPCIGC KQEIIAPWTE GSIGCDTDVA FAHCTGYADK SLRVSCPACK FNTTHDTLRV       300
     QKFRSDVQKL LKDDIPMPGT LLSQNGTPAD DGNGDNVSFP NRLIKEGIRS ELLQLTDLTE       360
     NESTTIETIR DHLEAYLKSR SVMRRVNKTI LASGNSSMPE RISLRNMLSR YWDNSSPFAI       420
     DLVGAVIRQG TFVDKMDNIG WVRSPNPRST MGHFIGKYGV FFQIMVKNKG HAVVPTLDVD       480
     LIWHTHQLSP IRYYIFSTTQ MEGIFINHDD KIDETKLNDA FAWTSRQYQK LTGGKIYSEC       540
     TCWYCEAVRE SNNQGLGRLI SPSTLHAKTN AALLHNSADN ATDGKSKEPH ISSHNAVRIL       600
     AQADPKAMQT KTAQLESCWE KAQRRSHNRS RSRGGGSAHG DPPRKTVYGP YARDPDIHRE       660
     IYPCNPACVN ITAGVVGNCM SGTQGVGLAQ ASQQMCKYLW TEPSVLQVSR ELDNV            715
//

If you have problems or comments...

PBIL Back to PBIL home page