(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE262

PENCW_16.PE262       Location/Qualifiers
FT   CDS             join(complement(596655..596946),complement(596276..596584),
FT                   complement(596131..596174))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947809"
FT                   /orf_name="Pc20g02620"
FT                   /product="Pc20g02620 protein"
FT                   /protein_id="CAP85591.1"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniParc:UPI0001831921"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH8"
FT                   /transl_table=1
FT                   /translation="MHTNYFFSALALALPVYSLSATARMGCYSEVDSFKNQGPYTYQSP
FT                   GYCQTECAENGFKVAALSRGNMCYCGNKMPSDSAKVADDKCDLSCSGWPAESCGGQDTF
FT                   NIIQATENLQASASENASTTIAPTAATAAGGIIVAPSTASSQTGIVTAASTASSKGGNV
FT                   VSKAAGSGSVATASPTPTYNAAGTVRAGSSLLGAVVAVILYPSLVRQQDVS"
     MHTNYFFSAL ALALPVYSLS ATARMGCYSE VDSFKNQGPY TYQSPGYCQT ECAENGFKVA        60
     ALSRGNMCYC GNKMPSDSAK VADDKCDLSC SGWPAESCGG QDTFNIIQAT ENLQASASEN       120
     ASTTIAPTAA TAAGGIIVAP STASSQTGIV TAASTASSKG GNVVSKAAGS GSVATASPTP       180
     TYNAAGTVRA GSSLLGAVVA VILYPSLVRQ QDVS                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page