(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE263

PENCW_16.PE263       Location/Qualifiers
FT   CDS             join(599867..600228,600297..601633,601690..601733)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194592" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977596"
FT                   /orf_name="Pc20g02630"
FT                   /product="Pc20g02630 protein"
FT                   /function="metallopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP85592.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="UniParc:UPI00018319E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH9"
FT                   /transl_table=1
FT                   /translation="MMKTLALLTLAVVPSLALNIPTQQRLFPESKLSGNHYNPLSTPST
FT                   RETCPQPRKVNTPNDGLHSSQTFLSDDAFRARQAKRLSRAVQIPTTVGDYMKDPYDEAF
FT                   EPIVEFQSLLEEMFPLVHDHANVEHINRLGLVFTFEGADTSLKPLLFMAHQDVVPIDDA
FT                   SDWTHPPFAGVFDGEWIWGRGSSDCKNVLIGLMSVVEDLLSQDWQPQRTVLFAFGFDEE
FT                   SHGFLGAGAISAALEEKYGKDSFEFILDEGGMGLQSLGDESNPNGEILYALPAVGEKGS
FT                   LDLIIDIAVPGGHSSIPPAHTGIGIMAEILYELERKELFPAWLDTTHPAYGMLECQAQY
FT                   SPEHVETWLSDKLAANDPAALGEAVASSRGPAVRYTVQTSQAADLIHGGVKTNALPEKI
FT                   SAVVNYRVALHQTPDELRERAIRLIRPIAESHNLTLRVDFPGVAESTEGDVSDRTLTLS
FT                   PLSVPLSPAPISPTNPLTSKVWAHFAGVARSVFESHSNPLSKSESGSKPTVVVTGDVMT
FT                   GNTDTRFYWSLSDNIYRWSPSRAGGSLNIHTVDERIRLDVHLEGMMLYYDLIRSFDAWD
FT                   GKSE"
     MMKTLALLTL AVVPSLALNI PTQQRLFPES KLSGNHYNPL STPSTRETCP QPRKVNTPND        60
     GLHSSQTFLS DDAFRARQAK RLSRAVQIPT TVGDYMKDPY DEAFEPIVEF QSLLEEMFPL       120
     VHDHANVEHI NRLGLVFTFE GADTSLKPLL FMAHQDVVPI DDASDWTHPP FAGVFDGEWI       180
     WGRGSSDCKN VLIGLMSVVE DLLSQDWQPQ RTVLFAFGFD EESHGFLGAG AISAALEEKY       240
     GKDSFEFILD EGGMGLQSLG DESNPNGEIL YALPAVGEKG SLDLIIDIAV PGGHSSIPPA       300
     HTGIGIMAEI LYELERKELF PAWLDTTHPA YGMLECQAQY SPEHVETWLS DKLAANDPAA       360
     LGEAVASSRG PAVRYTVQTS QAADLIHGGV KTNALPEKIS AVVNYRVALH QTPDELRERA       420
     IRLIRPIAES HNLTLRVDFP GVAESTEGDV SDRTLTLSPL SVPLSPAPIS PTNPLTSKVW       480
     AHFAGVARSV FESHSNPLSK SESGSKPTVV VTGDVMTGNT DTRFYWSLSD NIYRWSPSRA       540
     GGSLNIHTVD ERIRLDVHLE GMMLYYDLIR SFDAWDGKSE                             580
//

If you have problems or comments...

PBIL Back to PBIL home page