(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE264

PENCW_16.PE264       Location/Qualifiers
FT   CDS             join(complement(604461..604654),complement(604104..604396),
FT                   complement(603031..604054),complement(602779..602981),
FT                   complement(602585..602728),complement(602396..602531),
FT                   complement(602275..602344))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824380"
FT                   /orf_name="Pc20g02640"
FT                   /product="Pc20g02640 protein"
FT                   /protein_id="CAP85593.1"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="UniParc:UPI00018319E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEI0"
FT                   /transl_table=1
FT                   /translation="MQLYRLGLLVASFVSSIGAQSTFSPARPPAIPLAVRSPYLSTWLN
FT                   VGKDGGNGGYLAGQWPVFWENQVNGWTGMIRVDGNTYTWMGLPGSKTVNQTAFEYTSTK
FT                   SIFTMNVENKLEMNITFLSPVTPTDLKRQSLVFSYLNVEVSSLDGQKHDVQVYTDISAE
FT                   WVSGDRNAIAEWEYGTTDGVAYHKVHRQTQLAFTEKSQQGEWGNWYWATDDSKDMTHQS
FT                   GADTDVRGQFATTGKLSNGDDTNFRAISSVWPVFGFSYDLGSVDSSPVSTLFSLGLTQD
FT                   EAIQYEGASQYAPVPSLWKSYFATELAALSFFHKDYTESSNLASSLDRRVAQDSIATAG
FT                   QDYLVVTSLSVRQAFGATQLCGTQDKMYMFLKEISSNGNMNTVDVIFPAYPIFLYTNPE
FT                   LLKLVLTPLLENQEAGKYPNDYSIHDLGSSYPNATGHSDGSDEKMPLEECGNMLIMSLA
FT                   YVQKSGDSDFLNDHYSLLKQWTSYLVEDSLYPANQISTDDFAGPLANQTNLALKGMIGI
FT                   QAMAVIANMTGHTADAADYSRIAKDYITQWQDLAIAKGANPPRTTLSYGDTASHGLLYN
FT                   LFADAQLGLNLVPQSVYQMQSDFYPTVANKYGVPLDTRHTYTKGDWECFAAAVSSVDTR
FT                   DMFINDLATWINETPTNRALTDLYDTISGDYPQNTFVARPVMGGCFAPILVR"
     MQLYRLGLLV ASFVSSIGAQ STFSPARPPA IPLAVRSPYL STWLNVGKDG GNGGYLAGQW        60
     PVFWENQVNG WTGMIRVDGN TYTWMGLPGS KTVNQTAFEY TSTKSIFTMN VENKLEMNIT       120
     FLSPVTPTDL KRQSLVFSYL NVEVSSLDGQ KHDVQVYTDI SAEWVSGDRN AIAEWEYGTT       180
     DGVAYHKVHR QTQLAFTEKS QQGEWGNWYW ATDDSKDMTH QSGADTDVRG QFATTGKLSN       240
     GDDTNFRAIS SVWPVFGFSY DLGSVDSSPV STLFSLGLTQ DEAIQYEGAS QYAPVPSLWK       300
     SYFATELAAL SFFHKDYTES SNLASSLDRR VAQDSIATAG QDYLVVTSLS VRQAFGATQL       360
     CGTQDKMYMF LKEISSNGNM NTVDVIFPAY PIFLYTNPEL LKLVLTPLLE NQEAGKYPND       420
     YSIHDLGSSY PNATGHSDGS DEKMPLEECG NMLIMSLAYV QKSGDSDFLN DHYSLLKQWT       480
     SYLVEDSLYP ANQISTDDFA GPLANQTNLA LKGMIGIQAM AVIANMTGHT ADAADYSRIA       540
     KDYITQWQDL AIAKGANPPR TTLSYGDTAS HGLLYNLFAD AQLGLNLVPQ SVYQMQSDFY       600
     PTVANKYGVP LDTRHTYTKG DWECFAAAVS SVDTRDMFIN DLATWINETP TNRALTDLYD       660
     TISGDYPQNT FVARPVMGGC FAPILVR                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page