(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE265

PENCW_16.PE265       Location/Qualifiers
FT   CDS             join(604763..604811,604892..604964,605095..605275)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948837"
FT                   /orf_name="Pc20g02650"
FT                   /product="Putative uncharacterized protein Pc20g02650 "
FT                   /protein_id="CAP85594.1"
FT                   /db_xref="UniParc:UPI00018319E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEI1"
FT                   /transl_table=1
FT                   /translation="MPSTLTGRLKKGIKGIGPSETRMPECALYGGISKRLGILEGKGDR
FT                   GVVTVKKVVYFPRMAQMQSQIPKTRSGSFRKKRHAFRLHGRQAAVYADRRNEWRQ"
     MPSTLTGRLK KGIKGIGPSE TRMPECALYG GISKRLGILE GKGDRGVVTV KKVVYFPRMA        60
     QMQSQIPKTR SGSFRKKRHA FRLHGRQAAV YADRRNEWRQ                             100
//

If you have problems or comments...

PBIL Back to PBIL home page