(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE268

PENCW_16.PE268       Location/Qualifiers
FT   CDS             join(complement(614326..614759),complement(613111..614260))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948838"
FT                   /orf_name="Pc20g02680"
FT                   /product="Pc20g02680 protein"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /protein_id="CAP85597.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="UniParc:UPI00018319EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES3"
FT                   /transl_table=1
FT                   /translation="MATRLGPETDVNRRTSLGFLRRSKSTEPLGDQKSRKKMSKSQEEE
FT                   MRRQRESYAPKIPPRLPDLSPAPQLETFGGEERDKFDPIPIRPQSGLPASPSMGSVNNV
FT                   DPYARTESMTHRGRYSYASSAVSTVNSPRRVRRRKDPTSYNVLVIGARNSGKTSFLNFL
FT                   RSALTMPAHKHPSRTPEEVEELERQTSAWEGFTSQYLETEFDGERVGLTLWDSVGLERN
FT                   IADLQLRGVTGFLESKFEETLAEEMKVIRSPGARDTHIHCTFLLLDPMRLDENIAMAER
FT                   AANGTSKPTDAPVVGILDQNLDIQVLRTVLGKTTVVPVISKADTITSAHMSYLRKAVWN
FT                   SLKQANIDPLEILTLEDQEEEYSSESADEEEILVLETKPESTETGDANEANEAKESENA
FT                   TDNVPGSPSQLSQGTRRSNASQAANQHVPFSILSPDPHSLAAGDKPVGRRFPWGFADPY
FT                   DAEHCDFVRLKDSVFSDWRSELREASRVVWYERWRTNRLNRNGQPTPASPAQKQNYGGR
FT                   QGPHDGRRTR"
     MATRLGPETD VNRRTSLGFL RRSKSTEPLG DQKSRKKMSK SQEEEMRRQR ESYAPKIPPR        60
     LPDLSPAPQL ETFGGEERDK FDPIPIRPQS GLPASPSMGS VNNVDPYART ESMTHRGRYS       120
     YASSAVSTVN SPRRVRRRKD PTSYNVLVIG ARNSGKTSFL NFLRSALTMP AHKHPSRTPE       180
     EVEELERQTS AWEGFTSQYL ETEFDGERVG LTLWDSVGLE RNIADLQLRG VTGFLESKFE       240
     ETLAEEMKVI RSPGARDTHI HCTFLLLDPM RLDENIAMAE RAANGTSKPT DAPVVGILDQ       300
     NLDIQVLRTV LGKTTVVPVI SKADTITSAH MSYLRKAVWN SLKQANIDPL EILTLEDQEE       360
     EYSSESADEE EILVLETKPE STETGDANEA NEAKESENAT DNVPGSPSQL SQGTRRSNAS       420
     QAANQHVPFS ILSPDPHSLA AGDKPVGRRF PWGFADPYDA EHCDFVRLKD SVFSDWRSEL       480
     REASRVVWYE RWRTNRLNRN GQPTPASPAQ KQNYGGRQGP HDGRRTR                     527
//

If you have problems or comments...

PBIL Back to PBIL home page