(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE269

PENCW_16.PE269       Location/Qualifiers
FT   CDS             join(616139..616232,616335..616523,616583..616719,
FT                   616776..616904)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948839"
FT                   /orf_name="Pc20g02690"
FT                   /product="Putative uncharacterized protein Pc20g02690 "
FT                   /protein_id="CAP85598.1"
FT                   /db_xref="UniParc:UPI00018319EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES4"
FT                   /transl_table=1
FT                   /translation="MGVGHTGLACHANHYNIQHTEYSYFPGTSCQGKGLAFPTRNDRVE
FT                   QKWGGFPSRAGTFFFKENSQRDASVRVKGGIKVGTKLPFEQDSFSFDPQRAHITRLQVE
FT                   GQAFTLNSLSTLITVYQQNIPGGFGRPPDPQPLLLSTTKYSTDIYRLSVTLTLRRGFEA
FT                   YYKIEASEIEAYNLMEIPL"
     MGVGHTGLAC HANHYNIQHT EYSYFPGTSC QGKGLAFPTR NDRVEQKWGG FPSRAGTFFF        60
     KENSQRDASV RVKGGIKVGT KLPFEQDSFS FDPQRAHITR LQVEGQAFTL NSLSTLITVY       120
     QQNIPGGFGR PPDPQPLLLS TTKYSTDIYR LSVTLTLRRG FEAYYKIEAS EIEAYNLMEI       180
     PL                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page