(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE27

PENCW_16.PE27        Location/Qualifiers
FT   CDS             join(complement(70613..70739),complement(70435..70552),
FT                   complement(69601..70375),complement(69223..69546))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824084"
FT                   /orf_name="Pc20g00270"
FT                   /product="Pc20g00270 protein"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAP85356.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001831913"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF38"
FT                   /transl_table=1
FT                   /translation="MDSTPIEEQVPLPGKWPVDPQEDVPISEDRLWVDGCFDFSHHGHA
FT                   GAMLQARQLGKALYVGIHSDEAILENKGPTVMSLEERVAAVDACRWATQSVPHAPYVTY
FT                   LPWVSHYGCKYVVHGDDITSDSDGNDCYRFVKAAGRFRVVKRTPGISTTDLVGRMLLCT
FT                   RNHFVKSVKGTLAGLEGYGSPEERQASAKDLLRRIKDYATDESGLQPGPQVWTWTGSGT
FT                   AKMDHVVEEAGLFETLVDGKGPKPGQRVVYVDGGFDLFSSGHIAFLRKVTELEESEGRQ
FT                   RGWYEPDQVAKRLKDHGEDYGPSYIVAGIHDDDVINHWKGLNYPIMNIFERGLCVLQCR
FT                   YINAVIFSAPFTPSEPYLKAIPWGTPDAVYHGPTTFIPLTYDPYTAPKKMGIFREAEQH
FT                   AFQHVNAGEIVGRILKSREAYEARQRAKLDKAIAEDLVKSQEAAQAAQ"
     MDSTPIEEQV PLPGKWPVDP QEDVPISEDR LWVDGCFDFS HHGHAGAMLQ ARQLGKALYV        60
     GIHSDEAILE NKGPTVMSLE ERVAAVDACR WATQSVPHAP YVTYLPWVSH YGCKYVVHGD       120
     DITSDSDGND CYRFVKAAGR FRVVKRTPGI STTDLVGRML LCTRNHFVKS VKGTLAGLEG       180
     YGSPEERQAS AKDLLRRIKD YATDESGLQP GPQVWTWTGS GTAKMDHVVE EAGLFETLVD       240
     GKGPKPGQRV VYVDGGFDLF SSGHIAFLRK VTELEESEGR QRGWYEPDQV AKRLKDHGED       300
     YGPSYIVAGI HDDDVINHWK GLNYPIMNIF ERGLCVLQCR YINAVIFSAP FTPSEPYLKA       360
     IPWGTPDAVY HGPTTFIPLT YDPYTAPKKM GIFREAEQHA FQHVNAGEIV GRILKSREAY       420
     EARQRAKLDK AIAEDLVKSQ EAAQAAQ                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page