(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE271

PENCW_16.PE271       Location/Qualifiers
FT   CDS             join(complement(620634..620704),complement(620451..620583),
FT                   complement(620333..620390),complement(619968..620227))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194537" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128980"
FT                   /orf_name="Pc20g02710"
FT                   /product="Pc20g02710 protein"
FT                   /protein_id="CAP85600.1"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="UniParc:UPI00018319EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES6"
FT                   /transl_table=1
FT                   /translation="MTDAYAFSYPSPLEGYENLEPLTDERTEDGKSLKNPQHGVLSKAY
FT                   TEFPDPLSKGREGGFDVHIYHFQNNPDQAAYARALWERIRREFPELRIYTFFDRPVGPH
FT                   PVAMFEVNLFTPAQFGAFVPWLVINRGPLSALIHPNTVESEDERNHTQRATWLGDRIPL
FT                   DLSIFRPRKN"
     MTDAYAFSYP SPLEGYENLE PLTDERTEDG KSLKNPQHGV LSKAYTEFPD PLSKGREGGF        60
     DVHIYHFQNN PDQAAYARAL WERIRREFPE LRIYTFFDRP VGPHPVAMFE VNLFTPAQFG       120
     AFVPWLVINR GPLSALIHPN TVESEDERNH TQRATWLGDR IPLDLSIFRP RKN              173
//

If you have problems or comments...

PBIL Back to PBIL home page