(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE272

PENCW_16.PE272       Location/Qualifiers
FT   CDS             join(complement(622602..622699),complement(621336..622542))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217207" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948841"
FT                   /orf_name="Pc20g02720"
FT                   /product="Pc20g02720 protein"
FT                   /protein_id="CAP85601.1"
FT                   /db_xref="InterPro:IPR004882"
FT                   /db_xref="UniParc:UPI00018319EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES7"
FT                   /transl_table=1
FT                   /translation="MDDDYVAKVLAKEAKESSIKYASQGMSAFMPSRPTSNAPKPNTRF
FT                   LRNLIKVTDNHNTALKLKEEREARERMRQLKDKASGALGPTSPDHPSKRSDDRSEVRGS
FT                   RDHRRGDREDRNRSHRKRTRSRSPSAERDRSRRHRRRNEEYDGIRERDKDRDGHRREHR
FT                   DHGSSRKGRRDRDKEHTRRRRERSYSRSPSYSPHRDPSTDRHRHRRHKRQSGRSARSVS
FT                   RSRSPESYRSRRSKREDASPHGSRRSHLETSTQHKRVSPLSTITARQSEMGDESDPLED
FT                   LVGPLPPRQDEAPIRSRGRGAYKHNMSNIDAHFAPGYDPATDVHLDEDKLHSIGQESSR
FT                   RPVAGLMTKDDDWDMAMEALRDRERWRSKGEERLRTAGIDEAVIDKWKNNTAFAGMDGE
FT                   GKPEDVQWSKKGEGREWDRGKFVDDDGHIDIRASW"
     MDDDYVAKVL AKEAKESSIK YASQGMSAFM PSRPTSNAPK PNTRFLRNLI KVTDNHNTAL        60
     KLKEEREARE RMRQLKDKAS GALGPTSPDH PSKRSDDRSE VRGSRDHRRG DREDRNRSHR       120
     KRTRSRSPSA ERDRSRRHRR RNEEYDGIRE RDKDRDGHRR EHRDHGSSRK GRRDRDKEHT       180
     RRRRERSYSR SPSYSPHRDP STDRHRHRRH KRQSGRSARS VSRSRSPESY RSRRSKREDA       240
     SPHGSRRSHL ETSTQHKRVS PLSTITARQS EMGDESDPLE DLVGPLPPRQ DEAPIRSRGR       300
     GAYKHNMSNI DAHFAPGYDP ATDVHLDEDK LHSIGQESSR RPVAGLMTKD DDWDMAMEAL       360
     RDRERWRSKG EERLRTAGID EAVIDKWKNN TAFAGMDGEG KPEDVQWSKK GEGREWDRGK       420
     FVDDDGHIDI RASW                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page