(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE273

PENCW_16.PE273       Location/Qualifiers
FT   CDS             join(623023..623241,623313..623532,623596..624032)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948842"
FT                   /orf_name="Pc20g02730"
FT                   /product="Pc20g02730 protein"
FT                   /protein_id="CAP85602.1"
FT                   /db_xref="UniParc:UPI00018319F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES8"
FT                   /transl_table=1
FT                   /translation="MTDSSPEALAALQQLEQNGKLKDRLAIIRISDPISTEVGGSYPSP
FT                   SKRSSDASLSNFDDPTPASLEADLSHYKELFSKLRFSYLEQVTKEKFLRAIVGDPPVIV
FT                   GHNENMELETQLADVKAELKARKEDARIMIEEMEQMGRDLASRYKNVELQTTQLSTLPA
FT                   SIENLESTIAELRAKQIATMDPSDPNNSSSQNLPLPATLALLAEREAELAALNRQLAAV
FT                   HSALPRKTREAEAVERERSVLERRKSDAIAQAREAQRKKQQGESDGLEEIGRWYRGAEE
FT                   TLKELVGTQT"
     MTDSSPEALA ALQQLEQNGK LKDRLAIIRI SDPISTEVGG SYPSPSKRSS DASLSNFDDP        60
     TPASLEADLS HYKELFSKLR FSYLEQVTKE KFLRAIVGDP PVIVGHNENM ELETQLADVK       120
     AELKARKEDA RIMIEEMEQM GRDLASRYKN VELQTTQLST LPASIENLES TIAELRAKQI       180
     ATMDPSDPNN SSSQNLPLPA TLALLAEREA ELAALNRQLA AVHSALPRKT REAEAVERER       240
     SVLERRKSDA IAQAREAQRK KQQGESDGLE EIGRWYRGAE ETLKELVGTQ T                291
//

If you have problems or comments...

PBIL Back to PBIL home page