(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE274

PENCW_16.PE274       Location/Qualifiers
FT   CDS             join(complement(625256..625263),complement(625161..625198),
FT                   complement(625086..625104),complement(624910..625008),
FT                   complement(624401..624809))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977846"
FT                   /orf_name="Pc20g02740"
FT                   /product="Pc20g02740 protein"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAP85603.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI00018319F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES9"
FT                   /transl_table=1
FT                   /translation="MAPRVSSKTYKVPRRPFESARLDAELKTVGEFGLRNKREVWRVQL
FT                   TLSKIRRAARELLTLDEKDPKRLFEGNALIRRLVRIGVLDEGRMKLDYVLALKADDFLE
FT                   RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFSLTSPFG
FT                   GGRPGRVRRKKAAAAAGGEDAEEEEEE"
     MAPRVSSKTY KVPRRPFESA RLDAELKTVG EFGLRNKREV WRVQLTLSKI RRAARELLTL        60
     DEKDPKRLFE GNALIRRLVR IGVLDEGRMK LDYVLALKAD DFLERRLQTC VYKLGLAKSI       120
     HHARVLIKQR HIRVGKQIVN VPSFMVRLDS QKHIDFSLTS PFGGGRPGRV RRKKAAAAAG       180
     GEDAEEEEEE                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page