(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE275

PENCW_16.PE275       Location/Qualifiers
FT   CDS             join(626863..626898,627017..627084,627153..627200,
FT                   627316..627646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977847"
FT                   /orf_name="Pc20g02750"
FT                   /product="Pc20g02750 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85604.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="UniParc:UPI00018319F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET0"
FT                   /transl_table=1
FT                   /translation="MPHSYGLRAGTRYAFSRGFKEHGMIRLSTYMKTYRVGDIVDLKVN
FT                   GAVQKGMPHKVYHGKTGVVYNVTKSAVGVILYKKVDNRYLEKRISVRIEHVQHSRSRED
FT                   FIKRVKENAIKKREAKEKGVHVHLKRQAVGPREAHFVKQAGNKPETVVPIAYDTHI"
     MPHSYGLRAG TRYAFSRGFK EHGMIRLSTY MKTYRVGDIV DLKVNGAVQK GMPHKVYHGK        60
     TGVVYNVTKS AVGVILYKKV DNRYLEKRIS VRIEHVQHSR SREDFIKRVK ENAIKKREAK       120
     EKGVHVHLKR QAVGPREAHF VKQAGNKPET VVPIAYDTHI                             160
//

If you have problems or comments...

PBIL Back to PBIL home page