(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE277

PENCW_16.PE277       Location/Qualifiers
FT   CDS             join(complement(634203..634250),complement(633968..634138),
FT                   complement(633751..633900))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824629"
FT                   /orf_name="Pc20g02770"
FT                   /product="Pc20g02770 protein"
FT                   /protein_id="CAP85606.1"
FT                   /db_xref="UniParc:UPI00018319F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET2"
FT                   /transl_table=1
FT                   /translation="MKWQSTLFILGALSTQALGAKIMCNVDHDYADKGAIESGISYIRG
FT                   LSGQPTAEANKCNRVSCSWGSGIYLCADDGKDHTLQNWGVLADATQAVLDSCGNDSGVK
FT                   GRLMHEKGWGVAVQGAPC"
     MKWQSTLFIL GALSTQALGA KIMCNVDHDY ADKGAIESGI SYIRGLSGQP TAEANKCNRV        60
     SCSWGSGIYL CADDGKDHTL QNWGVLADAT QAVLDSCGND SGVKGRLMHE KGWGVAVQGA       120
     PC                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page