(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE28

PENCW_16.PE28        Location/Qualifiers
FT   CDS             join(71099..71301,71363..72116)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946681"
FT                   /orf_name="Pc20g00280"
FT                   /product="Pc20g00280 protein"
FT                   /protein_id="CAP85357.1"
FT                   /db_xref="UniParc:UPI0001831914"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF39"
FT                   /transl_table=1
FT                   /translation="MIPSTFAPGITRRDTAKSSGGHEGAYGIPPPVISGGGLLGPQSAG
FT                   AIYQHIHEMAAKRISTLDYLRKAHEGRVYWFNTVHFSRADIARLPYFEARKLSRRAINY
FT                   LLLGLSLPTILDVNSTPFEYVRALNALLMEFEAFQQVHPPDGSSSSTLARARIPQMFKR
FT                   AAHAGTKTRRASSANEIGLPMQSSDPSDLKSTAGNLGSASSASVTSFPLTESSDLHPGE
FT                   EYTYLLTPSLPFEPDFFETFATLCDVLIDTYSRLAALVSSPSVCTVALGETFSKADARL
FT                   RKIMVAGAVREFEDASRNSVKSEVAGVSRVVLGGLLG"
     MIPSTFAPGI TRRDTAKSSG GHEGAYGIPP PVISGGGLLG PQSAGAIYQH IHEMAAKRIS        60
     TLDYLRKAHE GRVYWFNTVH FSRADIARLP YFEARKLSRR AINYLLLGLS LPTILDVNST       120
     PFEYVRALNA LLMEFEAFQQ VHPPDGSSSS TLARARIPQM FKRAAHAGTK TRRASSANEI       180
     GLPMQSSDPS DLKSTAGNLG SASSASVTSF PLTESSDLHP GEEYTYLLTP SLPFEPDFFE       240
     TFATLCDVLI DTYSRLAALV SSPSVCTVAL GETFSKADAR LRKIMVAGAV REFEDASRNS       300
     VKSEVAGVSR VVLGGLLG                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page