(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE280

PENCW_16.PE280       Location/Qualifiers
FT   CDS             join(complement(644303..644751),complement(643622..644223),
FT                   complement(643389..643561))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194458" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128981"
FT                   /orf_name="Pc20g02800"
FT                   /product="Pc20g02800 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP85609.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001831ABF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET5"
FT                   /transl_table=1
FT                   /translation="MATDDDNFDIDIYGDGTYNANEPGEFKQDDSELVLDAPENQPQPS
FT                   TGPSNDANQENPTSTQGQQVNNNGAPSAPQQPSNHGLPAPPQGVKRKEFEDQSVDPDAT
FT                   TALLISDLSWWITEDDIRGLANQAGVEDQLKDVTFSEHKVNGKSKGQAFVEFTTARAAT
FT                   ATRHHIERNDTPARRHTVQYTTPHQNPFRTLPKDAPMRNAGGRGGGAAHPTGGNYGMNN
FT                   AGGGFRGRGSGFNRGMGHMNNFNNRNNFNPMGGFQGGGPNPMMGGFQGAPMGGMPNYGF
FT                   NNRGNMMGGGMRGNMRGGRGVGMGGGPNMMGMPAMTPPMGGMGMNPMAGMNPMMGGGMA
FT                   GGMGGNMPMQGQQGFQGPNPGFNQGYYNPNNPNNPNNPNNQNQASGSGSGSDGGSWNPH
FT                   GAKRSRQD"
     MATDDDNFDI DIYGDGTYNA NEPGEFKQDD SELVLDAPEN QPQPSTGPSN DANQENPTST        60
     QGQQVNNNGA PSAPQQPSNH GLPAPPQGVK RKEFEDQSVD PDATTALLIS DLSWWITEDD       120
     IRGLANQAGV EDQLKDVTFS EHKVNGKSKG QAFVEFTTAR AATATRHHIE RNDTPARRHT       180
     VQYTTPHQNP FRTLPKDAPM RNAGGRGGGA AHPTGGNYGM NNAGGGFRGR GSGFNRGMGH       240
     MNNFNNRNNF NPMGGFQGGG PNPMMGGFQG APMGGMPNYG FNNRGNMMGG GMRGNMRGGR       300
     GVGMGGGPNM MGMPAMTPPM GGMGMNPMAG MNPMMGGGMA GGMGGNMPMQ GQQGFQGPNP       360
     GFNQGYYNPN NPNNPNNPNN QNQASGSGSG SDGGSWNPHG AKRSRQD                     407
//

If you have problems or comments...

PBIL Back to PBIL home page