(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE283

PENCW_16.PE283       Location/Qualifiers
FT   CDS             join(complement(650480..650531),complement(650317..650414),
FT                   complement(650033..650236),complement(649890..649928),
FT                   complement(649689..649763),complement(649471..649644))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948846"
FT                   /orf_name="Pc20g02830"
FT                   /product="Putative uncharacterized protein Pc20g02830 "
FT                   /protein_id="CAP85612.1"
FT                   /db_xref="UniParc:UPI0001831AC2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF44"
FT                   /transl_table=1
FT                   /translation="MRLSNHLILFSTHLALSIAAGCGDADACVGTEICTTATFTTPTAT
FT                   TITTCRIVSPAVRAKSAAPHTVRPLNVDRLTQTGRTARRIMAHVWQMRTAATETSVWTD
FT                   FVLDLESRLSRELVVNVALELPNCPNYLSLYYPSGRTTIHCNGEPKPIPIERNIHIQKP
FT                   EIRLLQASVFQHIMRSSWFLKGQLSSTPYGNNAIPSHQSHRAGAGNTKWV"
     MRLSNHLILF STHLALSIAA GCGDADACVG TEICTTATFT TPTATTITTC RIVSPAVRAK        60
     SAAPHTVRPL NVDRLTQTGR TARRIMAHVW QMRTAATETS VWTDFVLDLE SRLSRELVVN       120
     VALELPNCPN YLSLYYPSGR TTIHCNGEPK PIPIERNIHI QKPEIRLLQA SVFQHIMRSS       180
     WFLKGQLSST PYGNNAIPSH QSHRAGAGNT KWV                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page