(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE284

PENCW_16.PE284       Location/Qualifiers
FT   CDS             651517..652554
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217600" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824630"
FT                   /orf_name="Pc20g02840"
FT                   /product="Pc20g02840 protein"
FT                   /function="carbon-sulfur lyase activity"
FT                   /protein_id="CAP85613.1"
FT                   /db_xref="GO:0016846"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniParc:UPI0001831AC3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF45"
FT                   /transl_table=1
FT                   /translation="MATKTLMASCQCKNFQFTVAVPTECFPLNIHLCHCSICRYTHGAP
FT                   CSFHAPLPVGVEPQFIAPSSLNKLTSYQHPASTATGYFCSTCGCQIGGADGQWVITPAI
FT                   FDANREDEGIWKFNAHMLPTSAPDGGLAAVFSLIDGHRMEIENLGLSPQAIAGSDSQPP
FT                   DPESKELLAQCHCGGVSFTIARPSEEFIASPRSKGWISPLDKSKWLASMDLCDDCRLVT
FT                   GTHVISWMFVSIDHITPRLPKDLLIGSAKGYRSSKDVLRVFCGTCGATVFYHCDGRPEI
FT                   VDVAMGILRAPEGAMAENWSVWRAGRASFPENGMRYHAGFSRALIEGMQRWGAERGHPQ
FT                   DFEIA"
     MATKTLMASC QCKNFQFTVA VPTECFPLNI HLCHCSICRY THGAPCSFHA PLPVGVEPQF        60
     IAPSSLNKLT SYQHPASTAT GYFCSTCGCQ IGGADGQWVI TPAIFDANRE DEGIWKFNAH       120
     MLPTSAPDGG LAAVFSLIDG HRMEIENLGL SPQAIAGSDS QPPDPESKEL LAQCHCGGVS       180
     FTIARPSEEF IASPRSKGWI SPLDKSKWLA SMDLCDDCRL VTGTHVISWM FVSIDHITPR       240
     LPKDLLIGSA KGYRSSKDVL RVFCGTCGAT VFYHCDGRPE IVDVAMGILR APEGAMAENW       300
     SVWRAGRASF PENGMRYHAG FSRALIEGMQ RWGAERGHPQ DFEIA                       345
//

If you have problems or comments...

PBIL Back to PBIL home page