(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE285

PENCW_16.PE285       Location/Qualifiers
FT   CDS             join(653177..653254,653433..653754,653818..653846)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234882" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824631"
FT                   /orf_name="Pc20g02850"
FT                   /product="Pc20g02850 protein"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAP85614.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI0001831AC4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF46"
FT                   /transl_table=1
FT                   /translation="MQSVPESRQQSFEEIYGPPENFLEIEVRNPQTHGTSRNMYTSYEI
FT                   VCRTNIPAFKLKHSVVRRRYSDFEYFRDILERESTRVTIPPLPGKVFTNRFSDDVIEHR
FT                   REGLQRFLQIVAGHPLLQTGSKVLASFIQDPNWDRNAW"
     MQSVPESRQQ SFEEIYGPPE NFLEIEVRNP QTHGTSRNMY TSYEIVCRTN IPAFKLKHSV        60
     VRRRYSDFEY FRDILEREST RVTIPPLPGK VFTNRFSDDV IEHRREGLQR FLQIVAGHPL       120
     LQTGSKVLAS FIQDPNWDRN AW                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page