(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE287

PENCW_16.PE287       Location/Qualifiers
FT   CDS             join(657129..657190,657259..657667)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194436" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824633"
FT                   /orf_name="Pc20g02870"
FT                   /product="Pc20g02870 protein"
FT                   /protein_id="CAP85616.1"
FT                   /db_xref="UniParc:UPI0001831AC6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF48"
FT                   /transl_table=1
FT                   /translation="MPTIFPTWPHILFGVLEPISLALGSVFPLYDLEGFIAGQTPTIAA
FT                   PATLHPSSVALAYQLGNVYSLLFLVGVGVCHATTEPRVLRNYLIGLAIADVGHVYATYL
FT                   AMGWDAFADVGAWNALTWGNIGITMFLFVNRIAYFLGIFGYAKAPKAAAKRE"
     MPTIFPTWPH ILFGVLEPIS LALGSVFPLY DLEGFIAGQT PTIAAPATLH PSSVALAYQL        60
     GNVYSLLFLV GVGVCHATTE PRVLRNYLIG LAIADVGHVY ATYLAMGWDA FADVGAWNAL       120
     TWGNIGITMF LFVNRIAYFL GIFGYAKAPK AAAKRE                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page